KEGG   Aspergillus oryzae: AO090120000287
Entry
AO090120000287    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; dual specificity phosphatase
  KO
K04459  dual specificity MAP kinase phosphatase [EC:3.1.3.16 3.1.3.48]
Organism
aor  Aspergillus oryzae
Brite
KEGG Orthology (KO) [BR:aor00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aor01009]
    AO090120000287
Enzymes [BR:aor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     AO090120000287
    3.1.3.48  protein-tyrosine-phosphatase
     AO090120000287
Protein phosphatases and associated proteins [BR:aor01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    AO090120000287
Motif
Pfam: DSPc Y_phosphatase PTPlike_phytase
Other DBs
NCBI-GeneID: 5996275
NCBI-ProteinID: XP_001824016
UniProt: Q2U6D2
Position
5
AA seq 680 aa
MATVVVQQQQQTLRHSTPPPTGISPALSLNRNPSPIPNKHLPFCPEGPTPIITHNASPLH
KEEVTDQTSSLLYPPDSYKQLSSSPAVYSIDAVTLEAALDHWASQPLPDPSKVFPWLHGL
HPENHLQLGFFTNRKRSLRRIPRVWRGITIIKVGGDLISGRLKGAVSLDEVLAPSTTEFL
AVDPREGFSVRNFQIQTAKLAPLSDIVIYGEDGVTRKQLLDVAGRVAAAQHRWRSKNDPE
QVLPVYNTFVLSSTFSEVQQRAPGIVAIHARGQLTGQIMDFFQWERWEMCDMSRASEIST
NIWQGPTPDYLLRPGTLEPTTGEYFDLLIEASDFASLPGPRFLAKLNKQLDDGPQRLEFP
SSGSILPPSGDDREVDDLVNTVRWLYYLANPDEPENRRDSDGDIAMDPMPKKPRKILIHC
PDGYTESSLLVIAYVMFAEGVTAPDAWLKLHCDKKRNFFAYPSDVTFLSAVQARLLHESP
ATPIGSLTGLEDPHWFKFFDGSLPSRILPYMYLGNLSHANNPEMLWALGIRRILSVGESV
TWTNSEVAKFGAENIMHVTQVQDNGIDPLTQELERCLDFVRKGKKDGTATLVHCRVGVSR
SATICIAEVMASLGLSFPRAYCFVRARRLNVIIQPHLRFVYELLKWEELQLQKQNKPPKR
ELEWPTVAREIALMNKPYSR
NT seq 2043 nt   +upstreamnt  +downstreamnt
atggcgacagtcgtggtacagcaacagcagcagacactgcgccactccacccctccccca
acggggatttcgccagcactgagtctgaacagaaacccttcgccgattccaaacaagcat
ctgcccttctgtccggagggtcccaccccaatcataactcacaatgcatcgccacttcac
aaggaagaagttacagaccagacatcttcccttctatatccaccagatagctacaaacag
ctgtcgagctcacccgcggtgtattcgatagatgcagtgactttagaagcagccctagac
cattgggcttcccagccgctcccagaccctagcaaggttttcccatggttacacgggctc
catcccgagaaccatctacagttggggtttttcacaaatcggaaacgctctcttcgtcgg
atccctagagtttggcgaggcattactattatcaaagttggtggggatctaattagcgga
aggctgaaaggagcagtatctctcgatgaggtccttgccccgtcaactacagagttcctt
gcggtcgaccctcgggaagggttctctgtgcgcaactttcagattcagactgcgaaatta
gctccgctgtctgacattgtcatctacggagaagatggcgttacccgaaagcaactacta
gacgttgctgggagagtcgcagctgcacaacatcgttggagaagcaagaatgacccggaa
caggtcttaccggtctataatacatttgtcctctcgtctactttttccgaagttcaacaa
cgtgccccgggcatcgttgccattcacgcccgcggacaactcactggccaaattatggat
ttctttcaatgggaacggtgggagatgtgcgacatgtcccgggcttctgagatttcaacc
aatatctggcaagggccaacccctgattatcttttaagacctgggactcttgagcctaca
actggggagtattttgatctgttaatcgaggccagcgactttgcgagcctcccaggccct
cgattcctggcaaaactgaataagcagcttgatgatgggccccagcggttggagttccct
tcgtctgggtctattcttccaccatccggtgatgatagggaggtggatgatctcgtcaat
accgtgcggtggctctactacttggcaaatccggacgaaccagaaaaccgacgagattcc
gacggggatatcgccatggatcctatgcctaaaaagcctcgcaagatacttatccactgc
ccagatggctatacagaaagctcactactggtcatcgcctacgtgatgtttgccgagggt
gtgacagcacctgacgcgtggctcaaacttcactgcgacaaaaagcggaacttctttgcc
tacccgtctgatgttacgtttctaagcgcagtccaagcgaggttattacacgaaagccct
gcgacaccaataggcagccttaccgggctcgaagatcctcactggttcaagttcttcgat
ggttcacttcccagtcggattctgccatatatgtatctcggcaatctatcgcacgcaaat
aatccagaaatgctgtgggctcttggcatcagacgtattttaagtgttggcgagtcagtt
acgtggactaattccgaggtggccaagttcggcgcagaaaacattatgcacgttacccag
gtccaagacaatggcatcgacccattgactcaggaactggaacgttgcttggattttgtc
cggaaagggaagaaggacggaacggctactttagtccattgccgagtgggggtttcgcga
tcagcgactatttgcatagcagaagttatggcatcattaggcctttcgttcccaagagca
tattgtttcgttcgcgcacgacggcttaatgttattatccagccacatctgcgttttgtc
tacgagctcctgaaatgggaagaactgcagctgcagaagcagaacaagcctccaaagaga
gaacttgaatggcccacagtggctcgcgaaattgcattgatgaacaaaccatactcgaga
taa

DBGET integrated database retrieval system