KEGG   Aspergillus oryzae: AO090120000329
Entry
AO090120000329    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; Ras-related GTPase
  KO
K07897  Ras-related protein Rab-7A
Organism
aor  Aspergillus oryzae
Pathway
aor04138  Autophagy - yeast
aor04144  Endocytosis
aor04145  Phagosome
Brite
KEGG Orthology (KO) [BR:aor00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    AO090120000329
   04145 Phagosome
    AO090120000329
   04138 Autophagy - yeast
    AO090120000329
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aor04131]
    AO090120000329
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aor04147]
    AO090120000329
   04031 GTP-binding proteins [BR:aor04031]
    AO090120000329
Membrane trafficking [BR:aor04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab GTPases
    AO090120000329
Exosome [BR:aor04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AO090120000329
  Exosomal proteins of other body fluids (saliva and urine)
   AO090120000329
  Exosomal proteins of colorectal cancer cells
   AO090120000329
  Exosomal proteins of bladder cancer cells
   AO090120000329
GTP-binding proteins [BR:aor04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab7/9 [OT]
    AO090120000329
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase PduV-EutP ATP_bind_1 cobW Septin AAA_16 AAA_5 AAA_22 SRPRB AAA_24 NTPase_1 AAA_7 ATPase_2 Glyco_hydro_75 NACHT NB-ARC
Other DBs
NCBI-GeneID: 5996313
NCBI-ProteinID: XP_001824054
UniProt: Q2U694
Position
5
AA seq 205 aa
MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSASYKATIGADFLTKEVLVDDRLVTMQ
IWDTAGQERFQSLGVAFYRGADCCVLVYDVNNSKSFEALDSWRDEFLIQASPRDPENFPF
VVIGNKIDVEESKRMISSKRAMTFCQSKGNIPYFETSAKEAVNVEQAFEVIARSALAQEE
AEEFSGEFSDPINIHLDSERDGCAC
NT seq 618 nt   +upstreamnt  +downstreamnt
atgtcgtcacggaagaaggttcttcttaaggtgatcattctgggcgatagcggcgtcggt
aaaacgagtttgatgaaccaatatgtcaacaagaagttcagcgccagctacaaggcaaca
atcggcgcggatttccttaccaaggaagttctagtagacgaccgactggtaacaatgcag
atctgggatacggcgggtcaagaacgttttcaatctttgggtgttgcgttttaccgagga
gccgactgctgtgttttggtatacgatgtgaacaactccaagagtttcgaggctctggac
agctggcgagatgaatttcttatccaagcaagcccgagagatcctgaaaactttcctttc
gtcgttattggtaacaagatcgatgttgaggagagcaagagaatgatttcctcgaaacgc
gccatgacgttctgccaatccaagggcaacatcccttacttcgaaaccagtgccaaggaa
gctgttaacgttgagcaggccttcgaagtcatcgctaggagtgctttggcgcaagaagag
gccgaagaatttagtggtgaattcagtgaccctatcaacatccaccttgatagtgaacgc
gatggatgtgcctgttga

DBGET integrated database retrieval system