KEGG   Aspergillus oryzae: AO090120000348Help
Entry
AO090120000348    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; pseudouridine synthase
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
aor  Aspergillus oryzae
Brite
KEGG Orthology (KO) [BR:aor00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aor03016]
    AO090120000348
Enzymes [BR:aor01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     AO090120000348
Transfer RNA biogenesis [BR:aor03016]
 Eukaryotic Type
  tRNA modification factors
   Psudouridine synthases
    AO090120000348
 Prokaryotic Type
    AO090120000348
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TruB_N TruB_C_2 Peptidase_M36
Motif
Other DBs
NCBI-GeneID: 5996329
NCBI-ProteinID: XP_001824070
UniProt: Q2U678
Position
5
AA seq 413 aa AA seqDB search
MSGEKIYEGVFAVHKPQGVTSADVIRTLQHHFNPSKLFKPWLETERARRDRESKNQRRRR
RTQRLDVKIGHGGTLDPLATGVLVTGVGKGTKQLNDFLGCTKTYETIVLFGAETDTYDRL
GKIVRRAPYEHVTREVVEKALEQFRGKIMQRPPIFSALKVKGKPLYEYAREGKEPPIEIQ
ERPVEVTDLRILEWYEPGTHDFKGPEQEAAAEEKAVAEKLLAKEDALPIAPSSEAAGSAE
KTAEQDTSASTKRKTPPPADSPKAAEDTAPAAAEGEKSPAAKKQKAAEGEAVPAQTEQSS
SNAPETAEEKSDALPEKAESAPQPQSAAVKIIMTVSSGFYVRSLAHDLGKAVGSCAMMSE
LIRTRQADFELGADKVLEYRDLEAGEEVWGPKVQQFLEQWEKKRAAEATVDQN
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgtccggagaaaagatctacgaaggtgtttttgccgtccataagccccagggcgtcacc
tccgccgatgtcatccgcaccctccaacaccacttcaacccttctaagctcttcaagcct
tggttagaaaccgagcgcgctcgccgagaccgcgagagcaagaaccagcgtagacggcgc
cgcacgcaacgcctggatgttaaaatcggccatggaggaaccctcgacccactggccacc
ggtgtgctagttaccggagtcggaaaaggcaccaagcagctcaatgacttcctgggatgt
accaaaacctacgaaacaattgtacttttcggagccgagacagacacctacgaccgactg
ggcaagatcgtccgacgggctccatatgagcatgtcacgcgcgaagtggttgagaaggcg
ctggagcagttccgggggaagatcatgcaacgcccgcctatcttttcggccttgaaggtc
aagggcaagccgctttatgaatacgctcgtgagggcaaggaaccaccaattgagatccag
gagagacccgtcgaggtgacggatctgcgtattctcgagtggtatgagcctggtacacat
gatttcaaggggcctgaacaagaggctgctgccgaggagaaagccgttgccgagaagctc
ctcgcgaaagaagatgctttacctattgcgccgtcttccgaagctgcaggatcggccgag
aagacagcagagcaggatacttcggcttcgacaaaacgcaagacaccaccacctgcagat
agtcccaaggcagctgaagatactgcaccagcagcggccgagggtgagaaatctccggcc
gcgaagaagcagaaggcagctgaaggcgaagcggttccggcacagaccgagcaatcctcg
tcaaatgccccagaaacggcagaagagaaatcagatgcgctgccagagaaggctgaatct
gcccctcaaccgcaatccgcggctgttaaaatcatcatgaccgtttcatcgggattctat
gtccgttccttggcacatgacctgggcaaggccgttggcagctgtgcaatgatgagtgaa
ctcatccggacccgccaggcagatttcgaacttggtgctgacaaagtacttgagtaccgg
gatctggaggctggtgaagaggtttgggggcccaaggtacagcagttcttggaacagtgg
gagaagaaaagggcggctgaggcgactgtcgatcaaaattaa

DBGET integrated database retrieval system