KEGG   Aspergillus oryzae: AO090120000354
Entry
AO090120000354    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; mitochondrial oxaloacetate carrier protein
  KO
K15117  solute carrier family 25, member 34/35
Organism
aor  Aspergillus oryzae
Brite
KEGG Orthology (KO) [BR:aor00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aor02000]
    AO090120000354
Transporters [BR:aor02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   AO090120000354
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 5996334
NCBI-ProteinID: XP_001824075
UniProt: Q2U673
Position
5
AA seq 310 aa
MSTTTGAFIAGGIAACGAVTVTHSFETVKIRLQLQGELQAKSEAVKKYKGVFHGVKVILQ
NEGPRGLFRGIGSAYIYQVLLNGCRLGFYEPLRKTLTTTIYQDPQVQSLGINVFAGAASG
IIGAAAGSPFFLVKTRLQSFSPFLPVGTQHNYHNSFDGLRKIYTSEGVGGLYRGVNAAMV
RTGFGSSVQLPTYFFAKRRLVKHLGMEDGPALHLASSTASGFVVCCVMHPPDTIMSRMYN
QTGNLYKGALDCLYQTVRKEGLLAIYKGYFAHLARILPHTILTLSLAEQTNKLMRRVEDR
FLSDSMKEAL
NT seq 933 nt   +upstreamnt  +downstreamnt
atgtcgacaacaacaggagcgttcatcgcaggaggaatcgcagcatgtggagctgtcaca
gtgacccatagttttgaaacagtcaaaatccgactacaattgcagggagaactacaagca
aagtccgaggcggtcaaaaaatacaagggtgttttccacggcgtcaaggtcatcttacag
aatgagggcccccgtgggctgttccgaggcatcggttccgcttacatctatcaagtgctg
ctcaatggctgccgtctaggattctacgaacccctgcgcaagactctcacaacaacgatc
tatcaagacccccaggtccagtcgttgggtatcaatgtctttgctggtgctgcctcgggt
atcatcggcgctgctgcaggttctccattcttccttgtcaaaactcgtctgcagtctttc
tcgccgttccttccagttggtacgcaacacaactatcataattcgttcgatggactacga
aagatctacacttctgagggagtaggcgggttataccgtggggttaatgcagccatggtc
cggacaggtttcggtagctctgttcagctgcctacctacttctttgctaagcgtcgcctg
gtcaagcatttgggaatggaagatggtcccgctcttcaccttgccagtagtacggcttct
gggtttgttgtatgctgcgtcatgcatcctcctgacactatcatgtcaagaatgtataac
cagaccggtaacctctacaagggcgcattggactgtctataccagaccgttcgtaaagag
ggcctgcttgctatttacaagggttatttcgctcatttggcccgtattttgcctcacact
atcttaacccttagcttggccgagcagaccaacaagctcatgcgcagggttgaggaccgg
ttcctctctgactcgatgaaggaagcactgtga

DBGET integrated database retrieval system