KEGG   Aspergillus oryzae: AO090138000202
Entry
AO090138000202    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; ankyrin
Organism
aor  Aspergillus oryzae
SSDB
Motif
Pfam: Ank_2 Ank_3 Ank Ank_5 Ank_4 PNP_UDP_1 NACHT AAA_22 AAA
Other DBs
NCBI-GeneID: 5997796
NCBI-ProteinID: XP_023093307
Position
6
AA seq 1462 aa
MGKRPLEMINVDGTGNEVKSKNGIQSSGPGIWSSPYGNEEYTIGWVSALPIEMAAAKGML
DEEHGDPQTPPQEADHNTYLLGAMSGFKVVIACLPKDELGASSAAVVATDMLFTFPNIRV
GLMVGIGAGIPHYDDNETRDIRLGDVVIGSDRGSSGVVVYDFGKRLPDGSFENIYALDRP
PRTLCTALAKMEAEHQTRENKICQYINSMLDKYPYMRKKGFAYPGSSYDQLFWDNYRHTG
GRSCAGCDPAQRIHREDRFDTSPEIHYGIVATGSAVVKHAPTRAQIKQRHGAICLEMEAA
GLINNFPCIVIRGISDYANSHKNDQWHSYAAATAAACAKELLGFVQPTALDAERKAKDAS
RDALISSSYIHRRKLTIMKVCDEVSQITTHVTHMNSAMEEGEKRKILTWLSPVDYGPQQS
DHFSRRQEGTGQWLLDSDPFQQWLEQSKTTLFCQGIPGAGKTIMASIVVNYLGIKFKDDC
HVAVAYIFCNFRRQNEQTSTDLLTSLLKQLACQTPTLPKCLKNLFGNHKNQQTRPTSDEI
WTALHTIGSSYEKVFIVIDALDECQVSEDATPVNIFTTSRFIDDIKEVFQKRRAIFLEIR
ARDNDIEKYLEGHMSSLPSFISRELSLANEVKARIVEVVDGMFLLAKLHLDSLQDKISYS
DVKNALRNLPKGVDAYEKAYSEAKGRIQGQMGGFRNLAMRILSWIVCSKRPLKTSELQHA
IAVQIDTRELDRDNITDVGLMTSVCAGLVTVDKSSSIVRLVHYTAQEYFEKEWRSWFPDA
NTDIAVTCITYLSFDTFGIGICKTDDDFEKRLLLYPLYDFAAVFWAHHVRSSRVDMEELI
AKLLKDGSKSSAVCQAIMVSGSSRHPNYSQKVPNDITGLHLAAQVGLVDIIRHFMERGYR
VNDKDSHGRTPLSWAAAEGHSEVVKLLLSYKDTEADLKDKDGRTPLGWASLGGHKEIAEL
LLAQGDVDPMTKNLHGQTPLIWASRNGHYDIVELLLNAEVDPDTEDKFNRTPLWWALRNG
HHNTARLLLEAGADPDLEESNGQTLISRALNSKHNEVVMMLQERGLHHPRRPGQTALSRA
AETSSLARVLLLLRKGQDPDNKDSDGRTPLSWAAQSGNISIMNLLLEAGANPTLKGDCGR
TPILWAVKHSQVGAVRHLLGYGADHMDIDGRTPLSWAAQFGDNCLVNVLLDHGANLELQD
NTGMSPLSWAVKNDQMSVISSLLKRGSNPNSSDIEGRTSLFWAVLNRQEEAILLLLEQGA
NPNCKDESSQTPLSLAVRCEQEAAVVTLLKYGADPNMKDDNNASPLLWATTYSQQNLVRL
LLANGADPDIPDIHGQTPFMRAVVTAQQEIAEALLQRGANPNTKVTAYGTTALHWAASRR
DESLIRLLLEKGADPNCADAVYGQTPLLWGVEHGLNQVILLLLEKGADPNVTDINGQTPM
SWAEYRGLEDLVKVMAEYGATC
NT seq 4389 nt   +upstreamnt  +downstreamnt
atggggaaaagacccctggaaatgatcaatgtcgacgggactggaaatgaggtgaagagc
aaaaatggcatccagagctcaggaccagggatttggagctccccgtatggcaacgaagag
tacacgataggttgggtctcggctctccctattgaaatggccgcagcaaaggggatgcta
gatgaagagcatggggatccacaaacgcctccacaggaggccgatcacaatacatatctc
ctaggagccatgagtggattcaaagtcgtcattgcttgcctgccaaaggatgaactgggt
gctagctctgccgccgttgttgcaacagacatgctgttcacctttcccaacatccgagtt
ggcctcatggtgggtattggcgcagggataccccattacgatgataatgaaacgcgcgac
atccgcttaggggatgtagttataggcagtgataggggctctagtggggttgttgtgtat
gactttggcaaacggctaccggatggctcgttcgagaatatatatgcgttggatcgaccg
ccccgaacgttgtgtactgcactagccaagatggaagcagagcaccaaactcgtgagaac
aagatctgtcaatacattaacagtatgctggataagtacccttatatgagaaagaaaggc
tttgcttatcctggctcttcatatgatcaactcttttgggacaactatcgccataccggt
ggtagatcctgtgcagggtgtgatcccgcccaacgaatacatcgagaagatcgatttgac
acttccccggaaatacattatggaattgtggcgacaggaagcgcggtggtaaagcatgcg
ccaactagagcgcagatcaagcagagacatggcgccatctgtcttgagatggaggcggct
ggattgataaacaacttcccctgcatcgtcatccgaggaatatcggactatgcgaattcg
cacaagaacgatcaatggcattcatatgcagctgctacagcagctgcctgtgcgaaggaa
cttctgggctttgtgcaaccgacggcgttggacgcggaacgcaaagctaaggatgcaagt
cgcgacgctttaatatcatcctcttatatccatcgccgcaaactaacaataatgaaagta
tgcgacgaagtgtctcaaattacaacccatgtgactcatatgaactcagccatggaggag
ggtgaaaagcgaaaaatactcacctggctcagtcccgtcgactacggcccacagcaaagt
gaccatttcagtaggcgacaggaaggaacgggtcaatggctactcgactctgaccccttc
caacaatggctcgaacagtcaaagacaacgctattctgccagggtattcccggggcaggt
aaaactatcatggcttccatcgtcgtcaattatctggggataaagttcaaggacgattgc
catgttgcagttgcctatatattctgtaactttcggcgccagaacgagcaaacatcgact
gatcttcttactagtctactgaaacagctagcttgccaaactcctacactgccaaaatgt
ttgaagaatctctttggaaatcataaaaaccaacagactcgtcctacctctgacgaaatc
tggacagcattgcacactatcggctcgagttatgagaaagtattcattgtcatcgatgct
ctggatgagtgtcaggtctcagaagatgcaactcccgtgaacatatttactacttcacga
tttatcgatgacataaaggaagtatttcaaaagcggagagctatatttctagagattcgc
gccagggacaacgatatagagaaataccttgaagggcatatgtcatctctaccgtctttc
atctcgagggagttgagtctagcaaatgaagtgaaggcacggattgtggaagtagttgac
gggatgtttctgcttgcgaagcttcacctagactctttacaagacaagatatcatatagc
gatgtcaagaatgctctgaggaacctccccaaaggagtagatgcatatgagaaagcttat
agtgaggccaagggaaggatccaaggacagatgggtggtttccgaaatctggctatgcgg
attctctcatggattgtctgttccaagaggcctttgaagacatctgaattgcaacatgct
atcgctgttcaaattgacacccgagagctcgacagagacaacattacagatgtgggacta
atgacatctgtttgtgcgggcctagtgacagtggacaagagcagtagtattgtccgattg
gtgcactataccgcacaggaatactttgaaaaggaatggagatcttggtttccagatgct
aatacagacattgctgttacttgcattacatatctgtcattcgatacttttggaattggt
atctgcaaaacagatgatgatttcgagaagagactgctactgtaccctctctatgatttt
gccgcagtgttctgggcccaccacgttcgttcaagtcgggtcgatatggaagaattgatt
gcgaaacttcttaaggatggatccaaatcgtcagcagtctgtcaggcgataatggtttct
ggatcttccagacatccaaactatagtcagaaggtacccaatgacattacagggctgcat
cttgccgcgcaggtcgggcttgtggatattatcaggcacttcatggaaagggggtaccgg
gtaaatgataaagacagccatggtcggactccactatcatgggcagcagcagaagggcat
agtgaagttgtgaaattacttctcagttacaaggataccgaagccgatctgaaggataag
gatggacgcaccccgctgggctgggcttcgctaggaggccataaggagattgcggagttg
ttactcgcccagggcgacgtggatccaatgacgaaaaatctgcacgggcaaacaccattg
atatgggcttcccggaacggccattacgacattgtcgagttgctcctgaatgctgaagtt
gatcctgatacagaagataaattcaacagaactccattatggtgggcattgaggaatggc
catcataatactgcgcgattactacttgaggctggagctgatccagatctggaagaaagt
aacggacaaactttgatttcgagagcgctgaacagcaagcacaatgaggttgtcatgatg
ttgcaagaaagaggcctgcaccaccctcgcagacctggacagacagctttgtcaagagct
gcagaaacatctagtctagccagagtgttattgcttctcaggaaagggcaggatccagat
aacaaggactctgacggtcgaacaccactatcatgggctgcacagtctggtaacatcagt
atcatgaatctcctcctcgaagcaggagctaatccgacgttgaaaggcgattgtggcagg
actcctatcctatgggctgtaaaacatagccaggttggagctgtccgtcacttacttggc
tatggtgcagaccatatggatattgacggccgaacgccactatcctgggccgcacaattt
ggggacaactgtcttgtaaatgtcctccttgatcacggtgcgaatttggaattgcaggac
aacactggtatgagtcctctctcatgggcggtcaaaaatgatcagatgtcagtcatcagc
tccctacttaagcgtggttcgaaccccaactccagcgatatcgagggccgaacttctctt
ttctgggcagtactgaataggcaagaggaagctatcttgctcctgcttgagcaaggtgcg
aatccgaactgcaaagatgagagtagccaaactccactttcattagccgtaaggtgtgaa
caagaggctgccgttgtaactttgctcaagtatggtgctgatcctaacatgaaagatgat
aacaacgcatccccgctactatgggcaacaacatatagccaacaaaatctggtcaggctc
ttacttgctaacggtgctgatccagacattccagacattcacggccagactcccttcatg
cgggcggttgtaaccgcccaacaagaaattgctgaagcgttattgcagcgcggtgcaaat
ccaaacacaaaagtgacagcttacggcacaacagcccttcactgggcagcatctcgccgc
gatgaatcactgattaggcttcttctcgagaagggcgcggaccctaattgtgcagatgct
gtctatggccagacaccgttgttgtggggagtagagcatgggctaaaccaagtcattcta
cttttgcttgagaaaggtgcggaccctaatgtcacagatatcaatggacagaccccgatg
tcatgggcagagtatcgcggactagaggatctcgtgaaggtaatggctgagtacggcgcc
acttgctga

DBGET integrated database retrieval system