KEGG   Aspergillus oryzae: AO090206000030
Entry
AO090206000030    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; holocytochrome c synthase/heme-lyase
  KO
K01764  cytochrome c heme-lyase [EC:4.4.1.17]
Organism
aor  Aspergillus oryzae
Pathway
aor00860  Porphyrin and chlorophyll metabolism
Brite
KEGG Orthology (KO) [BR:aor00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AO090206000030
Enzymes [BR:aor01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.17  holocytochrome-c synthase
     AO090206000030
SSDB
Motif
Pfam: Cyto_heme_lyase
Other DBs
NCBI-GeneID: 5998654
NCBI-ProteinID: XP_001826538
UniProt: Q2PIW9
Position
7
AA seq 324 aa
MGWFWADSPSQPTPVAPSPLASSGTTPPPACPMHTSNSPPVPSSVPEPPTACPVRSKDSP
FYVPPKSDTPLPSKAENKSTLSKLNPLNYMFSSISQERAPNQTVDLSLEREPSSIPRGDT
DGNWEYPSPQQMYNAMLRKGHTDTPQDAVEAMVAVHNFLNEGAWEEIVGWERLFSKGLKE
GWAKCRRGEENIALDAAREELTNAGALENQPRLLRFKGRPQELTPKAQVLQTLGWLYPAK
FGTPPPFDRHDWFVMRQTPSGPKEVRYVIDYYSGPPEPTGEPVFYLDIRPALDTPTAAIE
RMMRWGGDVWWRATGAAVRENGGN
NT seq 975 nt   +upstreamnt  +downstreamnt
atgggctggttctgggcagactctccatcgcagccaacacctgtggctccgagcccattg
gcatcctcgggcaccactccccccccagcatgtccaatgcacacgagcaactcgcctccg
gtgccatcctcagttcctgaaccacctactgcctgccccgtccggtctaaagattctccc
ttctatgtgccacctaagtcagatacgccattgccttctaaagcagaaaacaagtcaacc
ctatcaaagctgaaccctttgaactatatgttctcttccatctctcaggaacgagctccg
aaccaaaccgtcgatttgtcgctagagcgtgaaccttcctctataccccgcggagatacg
gatggcaattgggagtatccgtctcctcagcaaatgtacaatgctatgttgcgcaaaggt
cacacggatacccctcaagatgcagtggaggcaatggttgcagtgcataactttttgaat
gaaggcgcttgggaggaaattgttggatgggaacgtttattctcgaaaggtctaaaagaa
ggctgggcaaaatgtcgacgtggcgaggaaaacatcgcattagatgcagccagggaagag
ttgacaaacgcaggtgcactagagaatcagcctcgccttctcaggtttaagggccggccg
caggagcttactccaaaggcgcaggtactgcaaaccctgggttggctgtatccagcaaag
tttggaacacctccaccgttcgatcgacacgactggtttgtgatgcgacagacgccgtct
ggcccgaaagaagttcgttatgtgattgattactattcagggcctccggagccaacagga
gagccagtcttctatctggacatcaggcctgccttggacacgcctaccgctgctatcgaa
cggatgatgagatggggaggcgatgtttggtggcgagctactggtgctgcagttcgagag
aatggcgggaactaa

DBGET integrated database retrieval system