KEGG   Aspergillus oryzae: AO090701000038Help
Entry
AO090701000038    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; beta-fructosidases (levanase/invertase)
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
aor  Aspergillus oryzae
Pathway
aor00052  Galactose metabolism
aor00500  Starch and sucrose metabolism
aor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AO090701000038
   00500 Starch and sucrose metabolism
    AO090701000038
Enzymes [BR:aor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     AO090701000038
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C BNR
Motif
Other DBs
NCBI-GeneID: 5994989
NCBI-ProteinID: XP_001822932
UniProt: Q2U9G6
Position
5
AA seq 619 aa AA seqDB search
MPVLAGCEGAAIPANLVSQTQSYNSNLIENSLSCEQQVTSSRHVLYSRPLFHLTAPRGWL
NDPCGLGYDPATGLYHLSFQWNPKGNDWGNISWGHSVSQDLISWKTSPEPCLTPSAEYDS
CGIFTGCFRPSDINGVAGALTYIYTSVRRLPLHYTLPYEVGSESLSIAVSRDNGVTWQRL
DSNPILPAPPPDLNVTAWRDPYIGVWTAKQGEHDNDILPPLSLSGFLSGGIAGRTPTVFV
YSVNPDDLREWTYVGPLVNVGLNFRPSRWSGDLGVNWETTNWVVLTDHEGTTKNFIIMGV
EGCLVSEREQKRVSRSQLWMAVDPRPEQPKSEPIDALTDYAFSGIFDHGCAYAANSFWDP
VTSQYIVYCWITEEDLPDGIRHRQGWSGVISLPRSLKLTTLRNVTKTRHSNLSDVTSIEK
EANGEGSFTIRTLGVEPDQRLKKLRGEAQSITNVALWDRQHCGNYLSLTTSRWELEAEFA
VGKLCKLVGIEFQHDLDPRNSTVLAWAPCSETFSIHRPPPYDPGINHNPEIAPHTLFTFA
DESGMEKEETLRIHAFLDRNVLEVFVNERTVISTRIYTPCVESVSRLRFFAELDPSAPNL
KHAPAVLLKADLWDGLEAS
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgccagttctcgcaggatgcgaaggggccgcaatccctgctaatttggtgtcccagacc
caatcatacaattctaacctgattgagaattctttatcgtgtgaacagcaggttacgtct
tctcgtcatgttctatactcgcggccattgtttcacctaaccgctccccgcggctggtta
aacgacccttgcggccttggatatgaccctgcgactggcctatatcacctatcctttcaa
tggaacccgaaaggcaacgattgggggaacatttcctggggacattcagtttcacaggac
ctaatatcctggaagacatccccggagccatgtctaacaccttcagccgagtacgatagt
tgcggcatattcacaggctgcttccggccttctgatatcaacggggttgccggggctctc
acgtatatatacacttcggtgaggcgtttgcctttgcattatactttgccctatgaggtt
ggaagcgagtcgctcagtatagctgtttcgcgggataatggtgtaacatggcagcgtcta
gactccaacccaattctaccggcgcctcctcccgatcttaatgtgactgcttggcgagac
ccttatataggagtgtggacagcaaagcaaggtgaacacgacaatgacatattgccgcct
ctcagtctctctgggtttctctccggaggaatcgcggggcgaacaccaacagtcttcgtt
tactcagtcaatcctgatgatcttagagaatggacgtatgtggggcctctggtcaacgtt
gggctaaacttccggccatctaggtggtcgggcgacctgggggtgaactgggaaaccaca
aactgggtagtactaaccgaccacgaaggaaccacgaaaaactttattattatgggcgta
gaagggtgtttggtgtctgagagggagcagaagagggtctctcgatcgcagctatggatg
gccgtagacccccgtcctgaacaaccgaagagcgagccaatagatgccctcacagactat
gcattttccggaatattcgatcacggatgcgcctacgccgctaattccttctgggatccc
gtcacgtcacaatatattgtttattgctggatcacagaagaggatcttccagatggcatc
cggcatcgacaaggctggagtggtgtgatatctctcccacgcagtctaaagctgacgaca
ttgcgcaatgttacaaagacacgtcactcgaacctgagcgatgttacgtctattgagaag
gaagccaacggcgaagggagttttacaatccggacgttaggcgttgagccggaccagaga
ctgaagaaactccgcggggaagcccagagcattacgaatgtcgcgttatgggaccggcaa
cattgtggcaattacttatccttgacaacatcacggtgggagctagaggccgagtttgcg
gtcgggaagctgtgcaagctggtggggatagaatttcagcacgacttagatcctcgtaat
agcaccgtcctagcatgggcaccatgcagtgagacattctcaatccacagacctcctcct
tatgacccgggcatcaaccataatccagagatcgcaccgcataccttgtttacttttgca
gatgagagcggcatggagaaagaagagacacttcggatccatgcattcctcgatcgaaac
gtgctagaagtctttgtaaatgagagaacagtcatctcaacacgtatttacacgccatgt
gtcgagtctgtcagtcgtctacgattctttgctgaattagaccccagtgcaccaaatctg
aagcatgctcctgctgttctcctaaaagcggatttgtgggatggactggaagcatcatga

DBGET integrated database retrieval system