KEGG   Aspergillus oryzae: AO090701000123
Entry
AO090701000123    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; tuberin - Rap/ran-GTPase-activating protein
Organism
aor  Aspergillus oryzae
SSDB
Motif
Pfam: DUF3384 Rap_GAP Tuberin DUF776
Other DBs
NCBI-GeneID: 5995062
NCBI-ProteinID: XP_023092003
Position
5
AA seq 1508 aa
MSSDDASSPSNYKHATSSFADVFRSLGVARSKSLSPILGRENSDTLSQASDGHRNSWIAL
GLESMHRGSVVSSSSDASGAPDFETSIRNLAQKQNLAHAIDEAEHVAKSLHWFTSEQTLA
LWEAGSYLIHHATSPEARRSGSLLMEAIAARQDLSPTARRAVFELISCPSEADVVPARVI
SLISLSDHGRKLEFASSSSIIPIISSCVVPLYDLISTARLKARKAKIAKANGLAYDDAIL
DDLLQFAVDLITLQRKPPNSEEVRSLLDQLFIICKKTSVAADIKNSLAVFEAIILYSDVP
DESFVPLLEVLCNIYASVKSLSGPTSRTVRNLARSRRQDEMVNSLYGFLLGSSEEQGRNL
NILRGTVHVFTDLIRAYGQDGMPRLQFEQLMDSLLVVLKKDDGRLEADVLDLCLNALEGE
FSHVALERDWSIFINIIVSCSLRAVDESGDCSASSSSSQLSYPRASVLDDTRASILANII
QIASALETVWERMNRQQRLEATRFLMNVCQHVEPPQAELILNTMRGERLCFPENPDWVRH
CQRLIRCFVRSRTKPSEIRILALDTVNEAFTNYENLSQFRAHGLLNSMLENFSDEDDILF
LESLVSFVVDTSILVDDETSFVLLVDTLGSPMTQASERPVDSRLTVLKVLFRLRCDSSGS
IAVLSVSENDFLMNVSARNADSGPKPHTTVDDHTGEYSADNDNQRTSISGKLSTKDNASI
SSKSSGRNTGIPLRASKLTPPAWTHTSSQVLPEQPPDESSPFVYAYTTSDTSHHLESDPA
QKVALKANMWLETVISLLHRDTNWEIYSYVLTHLAPQLRNKDFFSNAVPQVKLLRSILCD
QVKNDSFREPPASTGVKKTDVAGYIFDTLCVLIGYHEFFAKSEEDELVRSFMMGIIGSWG
GTSRGCIHALSVCCHEIPLSVTKSLNGILDKMSKVITLANLAVHILEFLALLARLPDVYV
NLREEEIRTVFGICIRFLQTSREQRFKASESTNRNPQMSAKLGSGVRETAALPAEMSDPS
LQDGMSRYIYTLTHHVMVFWFLSLKLQDRAKHVNWITSRLIFRDEHGKEMVEEQSQVFLD
LMQRVAFTDLGETIPYATFPPSPADGPVSKKSWVVGMSIVTVEIAGVSGLTQITKRQASG
TTYAMYQQRTAPVLPHQVPPTPDAHLHGDGMRTAVLPSHVMLQLTTTAFPTPTAMQPVPL
PEDDITRRALSTFDRNDIVDGHKIGVIYIDDRQMTEADILSNTSGSPDYEYFLSRLGTKV
PLRGAQFNTQGLHPDIDGESTYAWRDRVTEIVYHVVTMMPTNFDNDPSCINKKRHIGNDF
VNIIFNRSNIPFNFDTIPSQFNFVNIVISPVCRIANGVEPANMDPEGYEKLFYHVQVMSK
PGFPEISPAAAPKIISGKNLAAFVRFLALNASVFSLVWNSQGGEHISSWRNRLREIKRLR
ERALGSQTQTSDAAEGAYPGQRRNTKANIFSEELPSRSTPAQSDFATDWNASADANILQN
LDFSRWGR
NT seq 4527 nt   +upstreamnt  +downstreamnt
atgtcttctgacgatgcttcatcaccttccaattacaaacacgcaacatctagtttcgca
gacgttttcagatcattaggcgttgcccgttcaaaatcgctttcgccaattttagggaga
gagaacagtgatacattgtcgcaagcgtcggatggacataggaatagctggatcgctctt
gggcttgaatcaatgcatcgcggcagtgttgtttccagctcttcagacgcttctggtgcg
ccagatttcgagacgtctataaggaacctggcgcagaaacaaaacctagctcatgcgatc
gacgaggcagagcatgtggcaaagtcgcttcactggtttacttccgagcaaactctagct
ctgtgggaggctggctcgtatttgattcatcatgcgacctctcctgaagcccggagaagt
ggctcgctattaatggaagctatcgcagcgcgccaagacctatctccaacagcaagaaga
gcggtctttgagttgatatcatgtccctcggaggccgacgtagtgcctgcgcgtgtgatc
tcgttgatttctctttctgatcatggaaggaagttagagttcgcttcttcttcttccatt
attccaatcatctcgtcatgtgtggttccgctctatgacctgatttcaaccgctcgacta
aaagcgagaaaagccaagatcgcgaaagctaatggactcgcctatgatgatgcaatccta
gatgacttgctgcagtttgctgttgacttaatcacgttacagaggaaacccccaaatagc
gaagaggttcgatcgttgcttgatcaactctttattatctgcaagaagacaagcgttgca
gctgacatcaaaaactctttggctgtgtttgaggctataattctctattcagatgtcccg
gatgaaagcttcgttccattgctagaggttctatgcaatatctatgcctcggtcaagtcg
ctgtctggccccacgtcacggaccgtgcgtaatctcgcaaggtcaaggaggcaggatgaa
atggtgaatagtctctacgggtttttacttggatcttccgaagagcaagggcgaaacctg
aacatcctgcgtggtacggtacatgtattcactgatcttatccgcgcgtatggtcaggat
ggtatgcctcggcttcagtttgagcagttgatggactctctactagttgtcctaaagaag
gacgacggcaggctggaagcagacgttctagatctgtgtctgaatgctcttgagggcgag
ttttcgcacgtggctctagaaagagattggtcgatttttatcaacataattgtctcatgt
tcgctcagagctgttgacgaatccggagactgttcagcctcaagctccagttcgcagcta
tcttacccaagagccagtgtgttggacgatacaagggccagcattttagccaacattatt
caaatcgcctctgctttagagactgtttgggagcgcatgaacagacagcaaagactggaa
gccacgcgtttcctgatgaatgtctgtcaacatgtagagcctccccaggctgagcttatc
ttgaatacaatgaggggtgaaaggctttgtttccctgagaaccctgactgggtacggcat
tgtcagaggttgatccgctgtttcgttcgatctcgcactaaaccatcagaaattcgcatc
ctagctttggatacggtaaatgaggctttcacgaactacgagaatctgtcccaatttcga
gcgcacgggcttcttaattccatgctggaaaacttctctgatgaggatgatatcttgttc
ctcgagtcactcgtatcgtttgttgtcgacacttctatccttgttgatgatgaaacttcc
ttcgttttattagtagacactctgggttctccgatgactcaggcctcggagagaccagta
gactctcgcttaacagtgctcaaggtgctatttaggctccgctgcgactcttcaggctct
atcgcagtcctctctgtctctgagaatgacttcttgatgaatgtttctgctcgaaatgct
gattccggccccaagccgcacactactgttgacgaccacacaggagaatacagtgcagat
aatgataaccagaggacatcgatttcgggtaaactatcaacgaaagacaatgctagtatt
tcctcaaagtcttctgggcgaaatacaggtatccctctacgtgcgtcgaagttgacgcca
ccagcctggacacatacgtcctcccaggtacttcctgaacaaccacccgatgaatcaagt
ccgtttgtatatgcttatacgacatccgacacatcccatcatctagaatcggatccagcg
cagaaggttgcattaaaagccaacatgtggttagaaactgtcatctcgctgttgcatcgc
gataccaactgggagatttacagctatgttctaactcatctcgcaccacagcttcgcaac
aaggatttctttagtaacgcagttcctcaagtcaagctgttgcgtagtatactgtgtgat
caggtcaagaacgattccttccgtgaacccccggcgtcgactggcgtgaaaaagaccgat
gtggcgggatatatattcgacaccttgtgcgtactaattggctatcatgaattcttcgct
aaaagcgaagaagacgaacttgtgcgttcgtttatgatgggcattattggatcctgggga
ggtacttctcgtggatgcattcacgccctttccgtctgctgtcatgaaatccctctctct
gtgacaaaatcattgaacgggatccttgacaagatgtcgaaagtgatcacattggccaac
cttgcagtacatattctggaattccttgcattactcgcacgattacctgacgtttatgtc
aatttgcgcgaagaggagatccgtactgtcttcggcatctgcattcgctttctacagact
tctcgagaacagcgcttcaaagcttccgagtcaacaaatcggaaccctcagatgtccgcg
aaactcggaagtggcgtgcgagagactgctgctcttcctgctgaaatgtcggacccatct
cttcaagacggaatgtcaagatatatttataccctaacgcaccacgttatggtgttttgg
ttcttatcgttaaaattacaagaccgggccaagcatgtcaattggatcactagcaggctt
atattcagggatgaacacggaaaagaaatggtcgaagaacagagtcaagtttttcttgac
ttgatgcaaagggttgcttttaccgatttaggcgagactattccatatgcaacattcccc
ccaagtccggcggatggccctgtatcaaagaagtcatgggtggtgggcatgagcatagtc
actgtggaaatagctggtgtgtccggcctaactcaaatcacgaagaggcaggcatcagga
actacgtatgccatgtaccagcaacggactgctcctgtccttccacatcaggttcctcca
acacctgatgctcatctgcatggtgatggcatgcgcactgctgtccttcccagtcacgtc
atgcttcagctaacaactacggcttttcctacaccgaccgcaatgcagccagttcccctg
cccgaggatgacatcacccgtcgggcactcagtaccttcgaccgaaatgatatcgtggat
ggacacaagatcggcgtcatctacattgatgatcgtcagatgaccgaggcagatattctt
tccaacactagtggtagccccgactatgagtactttctgtcaagacttggaacgaaggtt
cccctcagaggtgctcaattcaatacacaggggttgcaccccgatatcgatggggaatct
acctacgcctggcgtgaccgagtcacggaaatcgtgtaccacgtagtgacaatgatgcct
accaatttcgacaacgacccttcctgcatcaacaaaaaacgccacataggaaatgatttt
gtcaacatcattttcaatcggtcaaatattccgttcaactttgatacaattccatcacag
ttcaattttgtgaatatcgttattagtcctgtgtgccgtatcgcgaatggggttgagcct
gcaaacatggacccggagggctacgagaagctcttttaccacgtccaggtaatgagcaaa
cctggctttcccgagatctcacctgctgctgcgcccaagataatttccggaaagaatctg
gctgcctttgtacgctttcttgccttaaacgcgtcagtattttcgctagtctggaatagc
caaggaggcgagcatatttcctcttggcgaaaccggttacgggagatcaaaagacttcgg
gaacgagctttaggttctcagactcagacttctgatgccgcagagggagcttatcccggc
caacgccgcaacacgaaggctaacatattctccgaagaactgccatcacgtagtacccct
gcacagtcagattttgctaccgactggaatgcgtctgcggatgccaacatcctccaaaac
ttggatttctctcgatggggacggtga

DBGET integrated database retrieval system