KEGG   Actinomyces oris: AXE84_09485Help
Entry
AXE84_09485       CDS       T04280                                 

Definition
(GenBank) bifunctional riboflavin kinase/FMN adenylyltransferase
  KO
K11753  riboflavin kinase / FMN adenylyltransferase [EC:2.7.1.26 2.7.7.2]
Organism
aos  Actinomyces oris
Pathway
aos00740  Riboflavin metabolism
aos01100  Metabolic pathways
aos01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aos00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    AXE84_09485
Enzymes [BR:aos01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.26  riboflavin kinase
     AXE84_09485
   2.7.7  Nucleotidyltransferases
    2.7.7.2  FAD synthetase
     AXE84_09485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_syn Flavokinase CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: AMD99622
UniProt: A0A0X8K314
Position
2363106..2364131
Genome map
AA seq 341 aa AA seqDB search
MEVWYGAEQVPASLSASGGPGAVVTMGIFDGVHRGHQAVLGRVVELSHELAHGDRRPLAV
AVTFDPHPRSVHQPEADLPLIASLTDRLASLGDLGLDAVLVITYTLDFAAQSPQDFVRTW
LEELLGARAVVVGDDVRFGWRNSGDAATLEQIGRQDGFEVEIVSTICSDEGRRWSSTWIR
QCLKDGNMRQVSRVLGRPHRLRGVVVRGLRRGRELGFPTANLEAATAGVVPPDGVYAGWL
IRGCTDGADLQRLPAAISIGTNPTFDDVPQRTVEAHVLGRADLNLYGEEVGVELVERLRP
MLAFDGLDALLVQMRADIEDTARILGVPVPEPIRPEDVTAQ
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtggaggtctggtacggcgccgagcaggtgccagcgagcctgagcgcttcgggagggccg
ggcgccgtggtcacgatgggcatcttcgacggcgtccaccgcgggcatcaggcggtcctg
gggcgcgtcgtcgagctctcccatgagctcgcccacggcgaccggcggcccctggccgtc
gcggtcaccttcgacccccacccccgtagcgtccaccagcccgaggccgacctgcccctc
atcgcctccctgaccgaccgcttggcctccctgggggacctcggtctcgacgcggtcctg
gtcatcacctacaccctcgacttcgctgcccagagcccgcaggacttcgtgcgcacctgg
ctggaggagctgctcggggctcgcgcggtcgtcgtcggcgacgacgtccgcttcggttgg
cgcaactccggggacgcagccaccctggagcagatcggccgccaggacggcttcgaggtg
gagatcgtctccaccatctgctccgacgaggggcgtcgctggtcctcgacgtggatccgc
cagtgcctcaaggacgggaacatgcggcaggtcagccgggtcctgggccgtccccaccgg
ctgcgcggcgtcgtcgtgcgaggtctgcgccgcggccgcgagctcgggttccccaccgcc
aacctggaggccgccaccgccggtgtcgtgccgcccgacggggtctacgccggctggctg
atccgcggctgcacagacggggccgacctccagcggctgcccgccgccatctcgatcggc
accaatcccaccttcgacgacgtcccccagcgcacggtcgaggctcatgtcctggggcga
gccgacctcaatctctatggcgaggaggtgggggtcgagctcgtcgagcgcctgcgcccc
atgctcgccttcgatgggctcgacgcgctcctggtgcagatgcgcgccgatatcgaggac
accgcccggattctgggagtcccggtccccgagccgatccgtcccgaggacgtcaccgcg
cagtag

DBGET integrated database retrieval system