KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_1092
Entry
APP7_1092         CDS       T00717                                 

Symbol
pflB
Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
apa00620  Pyruvate metabolism
apa00640  Propanoate metabolism
apa00650  Butanoate metabolism
apa01100  Metabolic pathways
apa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:apa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    APP7_1092 (pflB)
   00640 Propanoate metabolism
    APP7_1092 (pflB)
   00650 Butanoate metabolism
    APP7_1092 (pflB)
Enzymes [BR:apa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     APP7_1092 (pflB)
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: ACE61744
UniProt: B3H1R7
Position
complement(1236787..1239099)
AA seq 770 aa
MTQLTEAQQKAWAGFTGGDWQTEVNVRDFIQKNYTPYEGDESFLAGATAATTKLWEEVME
KIKVENKTHEPYDIDCDIPSTITSHKAGYIDQALEKIVGLQTDAPLKRAIIPFGGIKMVK
GSCDVYRRTLNPEVEKIFTEYRKTHNQGVFDVYTPDILRCRKSGVITGLPDAYGRGRIIG
DYRRLAVYGADFLMKDKQKQFASLQPRLEAGEDIQATIQLREEIAEQHRALGQIKQMAAS
YGFDVSRPAETAQEAVQWTYFAYLAAVKSQNGAAMSFGRVSSFLDIYIERDLKAGKITEE
EAQELIDHLVMKLRMVRFLRTPEYDQLFSGDPMWATETLAGMGLDGRTLVTKNSFRILNT
LYTMGPSPEPNLTILWSEQLPDGFKRYCAKVSIDTSSVQYENDDLMRPDFDNDDYAIACC
VSPMVVGKQMQFFGARANLAKTMLYAINGGIDEKSGAQVGPKTAPITDEYLNFDDVMARM
DHFMDWLATQYVTALNIIHFMHDKYSYEAALMAFHDRDVFRTMACGIAGLSVAADSLSAI
KYAKVKPVRGDIKDKDGNVVATNVALDFEIEGEYPQFGNNDNRVDEIACDLVERFMKKIQ
THKTYRNATPTQSVLTITSNVVYGKKTGNTPDGRRAGAPFGPGANPMHGRDQKGAVASLT
SVAKLPFAYAKDGISYTFSIVPNALGKDYEAQKRNLAGLMDGYFHHEATVEGGQHLNVNV
LNRETLLDAVEHPEKYPQLTIRVSGYAVRFNSLTKEQQMDVITRTFTESM
NT seq 2313 nt   +upstreamnt  +downstreamnt
atgactcaattaactgaagctcaacaaaaagcatgggcagggtttactggtggcgactgg
caaactgaagtaaacgtacgtgattttatccaaaaaaactatactccatatgaaggcgac
gagtctttcttagctggcgcaacagctgcgacaactaagttatgggaagaagtaatggaa
aaaatcaaagttgagaacaaaactcacgaaccgtacgatattgattgcgacattccatca
acgattacttctcacaaagcgggttatatcgatcaagctttagagaaaatcgtaggtctt
caaactgatgcgccgttaaaacgtgcgattatcccgtttggcggtatcaaaatggttaaa
ggttcttgcgatgtttatcgccgtaccttaaaccctgaagtagaaaaaatctttaccgaa
tatcgtaaaacacacaaccaaggtgtgttcgatgtttatacgccggatattttacgttgc
cgtaaatcaggtgtaattaccggtcttccggatgcttacggtcgtggtcgtattatcggt
gactaccgtcgtttagccgtttacggtgcggatttcttaatgaaagacaagcaaaaacaa
tttgcttcattacaacctcgtttagaagcgggtgaagatatccaagccacaattcaatta
cgtgaagaaatcgcagaacaacaccgagcattaggtcaaatcaaacaaatggccgcatca
tacggttttgacgtttctcgcccggcggaaaccgcacaagaagcggttcaatggacttac
ttcgcataccttgctgcggttaaatcacaaaacggtgcggcaatgtcattcggtcgtgta
tcttcattcttagatatctatatcgaacgtgacttaaaagcaggtaaaatcacagaagaa
gaagcacaagagttaatcgaccatttagtaatgaaattacgtatggttcgtttcttacgt
acacctgaatacgatcaattattctcaggcgacccaatgtgggcaaccgagactttagca
ggtatggggttagacggtcgtacattagtaaccaaaaacagcttccgtatcttaaatacc
ctttacacaatgggtccgtcaccggaaccgaacttaactattctttggtctgaacaatta
ccggacggcttcaaacgttattgtgcgaaagtatctatcgatacttcatcagtacaatac
gaaaacgatgacttaatgcgtcctgacttcgataacgatgactatgcaatcgcatgttgc
gtatctccgatggttgtcggtaaacaaatgcaattcttcggtgcacgtgcaaacttagcg
aaaacaatgttatacgcaatcaacggcggtatcgatgaaaaatccggcgcacaagtcggt
ccgaaaacagcaccgattacagacgaatacttaaacttcgacgatgtaatggctcgtatg
gatcacttcatggattggttagcgacacaatatgtgaccgcattaaatatcatccacttc
atgcacgataaatacagctatgaagcagcattaatggcattccacgatcgtgatgtattc
cgtacaatggcgtgcggtatcgcaggtctttccgttgcggctgactcattatctgcaatt
aaatacgcaaaagtgaaacctgttcgtggtgacatcaaagataaagacggtaacgtagtc
gctacaaacgtcgcgttagacttcgaaatcgaaggcgaatatccgcaattcggtaacaat
gacaaccgtgtagatgaaatcgcttgtgacttagttgaacgtttcatgaaaaaaatccaa
acgcacaaaacttaccgcaatgcgacaccaacacagtcagtacttactatcacttctaac
gtggtttacggtaaaaaaactggtaatacgcctgatggtcgtcgtgctggtgcgccgttt
ggcccgggtgcaaacccaatgcacggtcgtgaccaaaaaggtgcggttgcgtcattaact
tctgttgcaaaacttccgtttgcgtatgcgaaagacggtatttcatataccttctcaatc
gtaccaaacgcattaggtaaagattacgaagcacaaaaacgtaaccttgcaggtctaatg
gacggttacttccaccacgaagcaaccgttgaaggcggtcagcacttaaacgtaaacgta
ttaaaccgtgaaacattattagatgcggttgagcatccggaaaaatatccgcaattaacc
attcgtgtatccggatatgcggtacgtttcaactctttaactaaagagcaacaaatggac
gtaattactcgtacatttaccgaatcaatgtaa

DBGET integrated database retrieval system