KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_0046Help
Entry
APP7_0046         CDS       T00717                                 

Gene name
nadR
Definition
(GenBank) transcriptional regulator NadR
  KO
K06211  HTH-type transcriptional regulator, transcriptional repressor of NAD biosynthesis genes [EC:2.7.7.1 2.7.1.22]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
apa00760  Nicotinate and nicotinamide metabolism
apa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    APP7_0046 (nadR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:apa03000]
    APP7_0046 (nadR)
Enzymes [BR:apa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.22  ribosylnicotinamide kinase
     APP7_0046 (nadR)
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     APP7_0046 (nadR)
Transcription factors [BR:apa03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    APP7_0046 (nadR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_28 HTH_19 HTH_3 HTH_31 CTP_transf_like HTH_26 FAD_syn MSV199
Motif
Other DBs
NCBI-ProteinID: ACE60698
UniProt: B3GZN6
Position
52636..53916
Genome map
AA seq 426 aa AA seqDB search
MTNFAYLQQKRKQLKMKVNDVCEQAGVTRAYFNQLVSGKIKNPSANKLKALHQVLNIVED
MNQRVGVIFGKFYPVHTGHIHMIYEAFSKVDILHVVVCTDAERDLQLFKDSKMKRMPTNE
DRLRWMQQIFKYQQKQIFIHHLKEDGIPSYPNGWQGWADRVKELFNEKNIRPSLVFSSEV
QDKEPYEKYLDLEVHLVDPKRESFNVSATKIRNNPFQYWRFIPKEVRPFFVKTIAILGGE
SSGKSVLVSKLANVFNTTSAWEYGREFVFERLGGNEQAMQYSDYPLMALGHQRYIDYAMK
HAHKVALIDTDYITTQAFCIQYEGKSHPFLDSMIKEYPFDVTILLSNNTKWVDDGMRSLG
SVKQRQRFQQLLKKLLEKYNVPYIEIESPSYLDRYNQAKEVVEAILKEEEIPLQFKQYNH
TTEDKE
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgacaaattttgcttaccttcaacaaaaacgcaaacaattaaaaatgaaagtaaatgat
gtttgtgagcaagccggcgtaactcgcgcttattttaatcaattggtaagcgggaaaatt
aaaaatccgagcgcaaataaattaaaagcgttacatcaagtattaaatatcgtggaagat
atgaatcagcgtgtcggggtcattttcggtaaattttatccggttcataccggtcatatt
catatgatctacgaagccttcagtaaagtggacattttacatgtggtggtttgtaccgat
gcggagcgtgatctgcaacttttcaaagacagtaagatgaagcgtatgccgaccaatgaa
gacagacttcgttggatgcaacaaatctttaaataccagcaaaagcaaatttttattcat
cacctcaaagaagacggcattccgagctatccgaacggatggcaaggttgggcggatcgc
gtaaaagaattattcaatgagaagaatattcgtccgtcgcttgtgtttagcagtgaggtt
caagataaagaaccgtatgaaaaatatttggatttggaagttcatctggttgatcctaaa
cgagagtctttcaatgtgtccgccactaaaattcgtaataatccgttccaatattggcga
tttatcccgaaagaagtacgtcctttctttgtaaaaaccattgcgattttaggcggggaa
agtagcggtaaatcggtcttggtcagcaaacttgccaacgtatttaatactacttccgct
tgggaatacggacgagaattcgtgtttgagcgtttaggcggtaatgagcaggcaatgcaa
tattccgattatccgctcatggcgttaggtcatcagcgatatatcgactatgcgatgaaa
cacgcgcataaagtggcattgattgataccgactatattactacgcaggcgttttgtatt
cagtacgaaggtaaatcacatcctttcttagattcgatgatcaaggaatatccttttgac
gtcacgattttattgtccaataacaccaagtgggtggacgacggaatgcgtagccttggc
tcggtcaagcaacgtcagcgttttcaacagttgttgaagaaactgctcgaaaaatacaat
gtgccttatatcgaaattgagtcgccgagctacttggatcgatataatcaagcgaaagaa
gtggttgaagccattttgaaagaagaagaaattccattgcaatttaaacagtataatcat
acgacggaagataaagaatga

DBGET integrated database retrieval system