KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_0492
Entry
APP7_0492         CDS       T00717                                 

Definition
(GenBank) hypothetical protein
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
SSDB
Motif
Pfam: DUF2190
Other DBs
NCBI-ProteinID: ACE61144
UniProt: B3H0Y2
Position
545249..545572
AA seq 107 aa
MAKNYIQDGNTVRLTAAKAIVSGDVLVSGDLIAIAVTDAAKNDAVVGLTTGVFNVKAKQA
DDIKQGAVLYWSETEGATLTAGGNKRLGIAWRDSGTSSDEVDVKINV
NT seq 324 nt   +upstreamnt  +downstreamnt
atggctaaaaactatattcaggatggtaataccgtccgcttaaccgcagcaaaagcaatt
gtttcaggggatgtcttagtgagcggcgatcttattgcgatcgctgttaccgatgctgca
aaaaatgatgcggttgtcggtttaacgacaggtgtgttcaacgtgaaagccaaacaagcg
gacgacatcaagcaaggtgcagtgctctactggtctgaaaccgaaggggcaaccttaacg
gcaggtggtaataaacgcctaggtattgcgtggcgagacagtggcacatcttctgatgaa
gtagatgtgaaaatcaatgtgtag

DBGET integrated database retrieval system