KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_0691Help
Entry
APP7_0691         CDS       T00717                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
apa00040  Pentose and glucuronate interconversions
apa00052  Galactose metabolism
apa00500  Starch and sucrose metabolism
apa00520  Amino sugar and nucleotide sugar metabolism
apa01100  Metabolic pathways
apa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:apa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    APP7_0691 (galU)
   00052 Galactose metabolism
    APP7_0691 (galU)
   00500 Starch and sucrose metabolism
    APP7_0691 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    APP7_0691 (galU)
Enzymes [BR:apa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     APP7_0691 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ACE61343
UniProt: B3H174
Position
complement(770709..771596)
Genome map
AA seq 295 aa AA seqDB search
MKVIIPVAGLGTRMLPATKAIPKEMLTIADKPLIQYIVNECVAAGIKEIVLVTHSSKNAI
ENHFDTSFELETMLEKRVKRQLLEEVRSIVPKDVTLMHVRQGQAKGLGHAVLCGRAVVGN
EPFAVVLPDVILADFTANQKTENLAAMIKRFNETQHSQIMVAPVPREDVSSYGVADCAGV
EIPAGETAKIVKMVEKPSVEEAPSNLAVVGRYVFSAGIWDLLEKTPVGVGDEIQLTDAID
MLIEQETVEAFHMTGRTFDCGDKLGYMQAFTEYSLRHDKFGNDFKEFIKKLAKTL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaattattccggtagcgggtttagggacgcgaatgcttcctgcaacaaaagcg
attccaaaagaaatgctgacgattgcggataaaccgcttattcaatatatcgtgaacgaa
tgtgtagcggctggtattaaagagatcgtattagtgactcattcttcaaaaaatgctatc
gaaaaccattttgatacgtcttttgaacttgaaactatgttggaaaaacgtgttaaacgc
caattattagaagaagtgcgctcaattgtgccaaaagacgttacattaatgcatgtacgt
caaggtcaagctaaaggtttaggtcatgcggtattatgcggtagagcggtagtcggtaac
gaaccttttgcagtcgtattaccggatgtaattttagccgattttactgcgaatcaaaaa
acggaaaaccttgcggcgatgatcaaacgtttcaacgaaacacaacatagccaaattatg
gttgcaccggtaccgagagaagatgtaagtagctatggcgtagcggattgtgcaggcgtg
gaaattcctgccggcgaaactgcaaaaatcgtgaagatggttgaaaaaccgagtgtagaa
gaagcaccttctaatttagcggttgtcggtcgttacgtattctccgcaggtatttgggat
ttattagagaaaacaccggttggtgtaggcgatgagatccaattaaccgatgctattgat
atgttaattgagcaagaaacggtagaagcatttcatatgacaggtcgtactttcgactgc
ggcgataaattaggttatatgcaggcatttaccgaatatagtttacgtcatgataagttc
ggcaatgactttaaagaatttattaaaaaattagctaaaacgttataa

DBGET integrated database retrieval system