KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_0761Help
Entry
APP7_0761         CDS       T00717                                 

Definition
(GenBank) putative phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Brite
KEGG Orthology (KO) [BR:apa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    APP7_0761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ACE61413
UniProt: B3GXF4
Position
856361..857623
Genome map
AA seq 420 aa AA seqDB search
MELIQQYGNILVIITAIFGFFMAFGIGANDVSNAMGTSVGSGTITARQAIVIAMVFEFAG
AYLAGGEVTETIKSGIIDISFFADKPDILVLGMMSALFAAGFWLLVASKMGWPVSTTHAI
IGAIIGFGCLTVGSEAVQWKQLGGIVGSWFITPVIAGFVAYWIFISTQKLIFDTDEPMKN
AQKYGPLYMALTAFILSIVTMTKGLKHVGLHLTTTETVLISSAIAAVAVVTCYFYFRSEA
FAKRAQGAAFGGVEKVFSILMLLTACSMAFAHGSNDVANAVGPLSAVVSIVHSGGVVEGK
AALASWILPLGAAGIAAGMLIMGYKVMGTMGTGITDLTPSRGFSAEFACATTVVIASGTG
LPISTTQTIVGAILGVGFARGIAALNLGIIRNIVASWVVTLPAGAIIAIVIYEILLMIFY
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggaactcattcagcaatatggcaatattttagtcattattactgcaatttttggtttt
tttatggctttcggtatcggggctaacgacgtatctaacgcaatgggaacatcggtaggt
tccggtacgattaccgcccgccaggctatcgtaattgcgatggtttttgaatttgccggt
gcttatcttgcaggtggagaagtaaccgaaacaattaaaagcggtattattgatatctca
ttttttgccgataagccggatattctggtattaggcatgatgtcggcgcttttcgccgca
ggtttttggctattagtcgcatccaaaatgggttggcctgtttctacaacacacgcgatt
atcggggcaattattggtttcggctgtttaactgtcggtagcgaagccgtacagtggaaa
caattgggtgggattgttggtagctggtttattacacctgttatcgccggttttgtcgct
tattggatttttattagtacgcaaaaacttattttcgataccgatgaaccgatgaaaaat
gcgcaaaagtacggcccgctctatatggcacttaccgcttttattttaagtatcgtgact
atgactaagggcttaaaacatgtcggtttgcatttaaccacaacggaaaccgtacttatt
tcctcagccatcgcagccgtcgccgtagtaacttgttacttctatttccgtagcgaagca
tttgcaaaacgcgctcaaggtgctgcatttggtggtgtagaaaaagtattcagtatttta
atgcttttaaccgcttgttcaatggcattcgcacacggctcgaacgatgtggcaaatgcg
gtcggtccgttatccgcagtggtatctatcgtgcatagcggcggtgttgtggaagggaaa
gcggcattggcttcatggattctaccgttaggtgcggcgggtatcgcagccggtatgctt
atcatgggctataaagtaatgggaacgatgggtaccggtattacggatttaacgccaagc
cgcggtttctctgccgaatttgcttgtgcgactaccgtagtaatagcttcaggtaccggt
ttacctatttcaacgacacaaaccattgtaggggcaatcttaggtgtcggatttgctcgc
ggtattgcagccttaaacttaggtattattcgtaatattgttgcctcatgggtcgtcaca
ttaccggcaggcgcaatcattgcaattgttatctatgaaatcttattaatgattttttat
taa

DBGET integrated database retrieval system