KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_1066Help
Entry
APP7_1066         CDS       T00717                                 

Gene name
hemD
Definition
(GenBank) putative uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
apa00860  Porphyrin and chlorophyll metabolism
apa01100  Metabolic pathways
apa01110  Biosynthesis of secondary metabolites
apa01120  Microbial metabolism in diverse environments
Module
apa_M00121  Heme biosynthesis, glutamate => heme
apa_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:apa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    APP7_1066 (hemD)
Enzymes [BR:apa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     APP7_1066 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 dCache_2
Motif
Other DBs
NCBI-ProteinID: ACE61718
UniProt: B3H1P1
Position
complement(1206665..1207429)
Genome map
AA seq 254 aa AA seqDB search
MNVLITRPDYRGQELVEMLNQYQIFAIHQPLFTIEAGTELPQLPSVMSRLNTDDYVFAVS
KHAIDFASETLVQTGFQYRSDLKYFAVGRQSAAYFSTKTAYPTYYPISSENSEGLLELPE
MQCLEGKNILVLRAEKGRDFFAEQASLRGANVQYLECYRRKYAEDNITEKMSLCKRAGID
SIIVTSSDILAALYEQTAELDRQWLIECRLIVVSSRIAQLAYKLGWGRNKVLLSEKADNN
SLLESVLKFIDKSN
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgttaattactcgccctgattatcgtgggcaggaattagttgaaatgttgaat
cagtatcagatttttgcgattcatcagccgttatttacgattgaagccgggacggaatta
cctcagcttccgtcggttatgtctcgtctgaatacggatgattatgtatttgccgtttct
aaacatgccattgattttgcttcggaaacgctcgtacagacaggttttcagtatcgttcc
gatttaaaatattttgcggtgggaagacaatccgcagcctatttttcgacaaaaacagcg
tatcctacgtattatccgatctcttccgagaatagtgagggattactggaattacctgaa
atgcagtgcttagaaggaaaaaatattctcgttttacgagcggagaaagggcgggatttt
tttgcggaacaagcgagtttacgaggagcaaatgtccaatatttagagtgttatcgtcgt
aaatatgcggaagataacattactgaaaaaatgagtttgtgtaaacgagccggcattgat
agtattatcgtgacaagttcggatattttagccgctttatacgaacaaacggcggaactc
gatcgtcagtggttgattgaatgtcgtttaatcgtcgttagctctcgtatcgctcaactg
gcgtataaattgggttggggtagaaataaggttctactgtccgaaaaagcggataataat
agtctgctggaaagcgtattgaaatttatcgacaaatctaactaa

DBGET integrated database retrieval system