KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_1337Help
Entry
APP7_1337         CDS       T00717                                 

Gene name
murA
Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
apa00520  Amino sugar and nucleotide sugar metabolism
apa00550  Peptidoglycan biosynthesis
apa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    APP7_1337 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    APP7_1337 (murA)
Enzymes [BR:apa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     APP7_1337 (murA)
Peptidoglycan biosynthesis and degradation proteins [BR:apa01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   APP7_1337 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase DUF520
Motif
Other DBs
NCBI-ProteinID: ACE61989
UniProt: B3H259
Position
complement(1494694..1495968)
Genome map
AA seq 424 aa AA seqDB search
MEKFRVHGPFTLSGTVDISGAKNAALPILFAAVLATEPVTLTNVPDLKDVDTTFKILRKL
GVVVERDESGAVQIDASKIDHYVAPYELVKTMRASIWALAPLVARFHEGQVSLPGGCTIG
ARPVDMHISSLEKMGALIELDEGYVKATSNGRLHGARIYMDKVSVGATLSVMMAATLAEG
TTTIENAAREPEIVDTALFLNAMGAKISGAGTDTITIEGVERLTGCQHRIVADRIETGTF
LVAAAVSGGKITCRGTKADTLEAVIEKLREAGMEVTVTEDTITLDSKGQRPKAVNIRTMP
HPGFPTDMQAQFTLLNVVAEGTSRITETIFENRFMHIPELNRMGAKGEIEGNTAICHGVE
KLKSAEVMATDLRASISLVLAGCIASGETIVDRIYHIDRGYEHIEDKLRGIGAKIERFST
KFEE
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatttcgtgttcacggtccttttacattaagcggaaccgttgatatttcaggt
gctaaaaatgcggcactcccgattctttttgctgccgttttggcaacagaacctgtgact
ttaactaatgttcctgatcttaaagatgtggacacgacatttaaaatcttacgtaaatta
ggcgtagtggttgaacgtgacgaaagcggcgcagtacaaattgatgcaagtaaaatcgat
cactacgttgcgccttatgaattggtcaaaaccatgcgtgcttcgatctgggcattagca
ccgcttgtcgctcgcttccacgaagggcaagtttcattaccgggcggttgtacgattgga
gctcgtcccgtcgatatgcatatttccagtttagaaaaaatgggtgcgcttatcgaattg
gatgaaggttatgtgaaggcgacttcaaacggtcgtttacacggtgcgcgtatttatatg
gataaagtcagcgtaggtgcgacattatcggtaatgatggcggcgaccttagcggaaggt
acaacgacaattgaaaatgcggcgcgtgaacctgaaatcgtagataccgcattattctta
aacgcaatgggagcaaaaatctctggtgcgggtactgatacgattactatcgaaggtgtg
gaacgtttaaccggttgccagcatcgtatcgttgccgaccgcattgaaaccggcacattc
ttagtcgccgcagcggtatccggcggtaaaattacttgtcgcggaaccaaagcggatact
ttagaagcggtaattgaaaaattacgtgaagcgggtatggaagtcaccgtaaccgaagat
acgattacgttagactcaaagggtcagcgtccgaaagcggtaaacattcgtactatgccg
catccggggttcccaaccgatatgcaagcgcaatttactttgcttaacgttgtagcggaa
ggaacaagccgtattaccgaaacgatttttgaaaatcgttttatgcatattcccgaacta
aatcgtatgggggcaaaaggtgaaattgagggtaataccgcaatttgccacggtgttgaa
aaattaaaatcggcggaagtgatggcgacggatttacgcgcatcaattagcttagtatta
gccggttgtattgcttcaggtgaaactatcgtggatcgtatttatcacattgaccgcggt
tatgaacatattgaagataaattacgtggaatcggggcaaaaatcgagagattttcaact
aagtttgaagagtaa

DBGET integrated database retrieval system