KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_1978
Entry
APP7_1978         CDS       T00717                                 

Definition
(GenBank) hypothetical protein
  KO
K09911  uncharacterized protein
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Brite
KEGG Orthology (KO) [BR:apa00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    APP7_1978
SSDB
Motif
Pfam: MatP MatP_C RHH_4 DUF2288 Nbs1_C XET_C
Other DBs
NCBI-ProteinID: ACE62630
UniProt: B3H2W0
Position
2183794..2184240
AA seq 148 aa
MRYQKLEIQEANWKWKYLLKKHREGENITKYEETSLIELKVQLLTTLQHSPEEIEQWIKQ
EMTAEQRKKMRQSVRARRKRYFNAEKITTKKKSIDLEYASWLRLSKYAKEKEMTLSEAVN
YLMDELENQQIYQEQMAKMKSSLKDLLK
NT seq 447 nt   +upstreamnt  +downstreamnt
atgcgatatcaaaaattagagattcaagaagcgaattggaaatggaaatatctgctgaaa
aaacatcgtgaaggcgagaatattaccaaatatgaagaaaccagtttaattgagttaaaa
gttcagcttttaaccacgcttcaacattctccggaagaaatcgaacagtggattaaacaa
gaaatgaccgccgaacaacgtaagaaaatgcgtcagtcggtacgagcaagacgtaaacgt
tatttcaatgcggaaaaaattaccaccaagaaaaagtcgatcgatttggaatacgccagc
tggttgcgcttatccaaatatgccaaagaaaaagaaatgacgctgtcggaagcggtcaat
tacttaatggacgaattggaaaatcagcaaatctatcaagaacaaatggcaaaaatgaaa
tccagtctgaaagatttattaaaataa

DBGET integrated database retrieval system