KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_2057Help
Entry
APP7_2057         CDS       T00717                                 

Gene name
dfp
Definition
(GenBank) Coenzyme A biosynthesis bifunctional protein coaBC
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
apa00770  Pantothenate and CoA biosynthesis
apa01100  Metabolic pathways
Module
apa_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:apa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    APP7_2057 (dfp)
Enzymes [BR:apa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     APP7_2057 (dfp)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     APP7_2057 (dfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein PEP_hydrolase
Motif
Other DBs
NCBI-ProteinID: ACE62709
UniProt: B3H339
Position
complement(2258215..2259420)
Genome map
AA seq 401 aa AA seqDB search
MLDNKRILVGITGGIAAYKTIELIRHFKKANADVRVVLTPAAEAFVTPLTLQAISANAVS
TSLLDPQAELAMGHIELAKWADLVVIAPASADFIARLRAGMANDLLSTLCLATASPILLA
PAMNQQMFKQAITQENLAVLANRGVQMIGPNSGFQACGDVGAGRMSEPSELFQAVCDHFN
HIQDLKDISVTITAGPTREAIDPVRYISNHSSGKMGFAIAEAFAKRGATVNLIAGPVNLA
TPANVTRIDVESAVEMEQQAVKFAQKSAIFIGCAAVADYRMAEVSTQKIKKTADNNELML
KLVKNPDIIANVANLTENRPFTVGFAAETQDVASYAKDKLKRKNLDLICANDVSGGQVFG
QDQNALQLFWQDGEKMLPLADKSKLAEALVHEIIEQFKHDK
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgctcgataacaagcgcattttagtgggtattaccggtggaatcgccgcttataaaacg
attgaattaattcgtcatttcaaaaaagccaatgccgatgtgcgagtggttttaacgcct
gcagcagaagccttcgttactccgcttaccctgcaagcgatttcggcgaatgcggtatca
acttctctgttagatccgcaagcggaattagcgatgggtcatatcgaactggcaaaatgg
gcggatttagtcgttattgcgccggcatccgccgattttatcgcgcgtttacgtgccggt
atggcaaatgatttgctctccaccctctgcttggcaaccgccagcccgattttactcgca
ccggcaatgaaccaacaaatgttcaaacaagcaatcacgcaagaaaatttagcggtgttg
gcaaatcgcggcgtgcaaatgatcggcccgaatagcggtttccaagcttgtggtgatgtc
ggtgccggcagaatgtccgagccgagcgagctcttccaagcggtatgtgatcactttaac
catatacaagatctgaaagatattagtgtgacaattaccgccggtccgacccgtgaagcg
atcgatccggtacgttatatcagtaatcacagctccggcaaaatgggctttgcaattgcc
gaagccttcgccaaacgtggcgcaactgtaaatctgattgccggcccggtcaatcttgcc
acaccggcaaatgtcactcgaatcgatgtagaatctgcggtagaaatggagcaacaagcg
gtcaaatttgcgcaaaaatctgcaatctttatcggttgtgccgcggttgccgactatcgt
atggcggaggtatcgacccaaaaaatcaagaaaaccgctgataataacgagctgatgctt
aaattggttaaaaatccggacattatcgccaatgtggcgaatttaaccgaaaatcgtccg
tttaccgtcggctttgcggcagagacgcaagatgtcgcaagctatgccaaagataaactt
aaacgcaaaaacttagatttaatctgtgctaatgatgtgtccggcggacaggtattcggg
caagatcaaaatgctctgcaactcttttggcaagacggtgagaaaatgctaccgcttgcc
gataaaagcaaactggcggaagccttagttcacgagattattgagcaatttaaacacgac
aaatag

DBGET integrated database retrieval system