KEGG   Alcanivorax pacificus: S7S_01795Help
Entry
S7S_01795         CDS       T03580                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
apac  Alcanivorax pacificus
Pathway
apac00780  Biotin metabolism
apac01100  Metabolic pathways
Module
apac_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:apac00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    S7S_01795
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:apac01007]
    S7S_01795
Enzymes [BR:apac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     S7S_01795
Amino acid related enzymes [BR:apac01007]
 Aminotransferase (transaminase)
  Class II
   S7S_01795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AJD46783
UniProt: A0A0B4XJN5
Position
373075..374247
Genome map
AA seq 390 aa AA seqDB search
MAATSAFDLETALAERRRLHRYRTRLNTDAPAGRETVVDGRRYLNFCANDYLGLANHPDV
VQALKQAADDIGVGSGASHLVCGHSRFHHALEEQLADATGRPRALLFSTGFMANLGVVGA
LLDKPDAVFEDKLNHASLIDAGLASGARFRRYLHNDADSLAAQLARADARRKLVITDGVF
SMDGDAAPLAALCDVADAHDAWMMVDDAHGFGVLGEQGVGTPAAQQVAARIPVYMATLGK
ALGTFGAFVAGSEALIETLIQFARPYIYTTAMPPAVAAATLKSLAIMRTETWRREKLVAL
IAQFRRGAQAQGYTLMDSATPIQPLLIGDDAAALQLSGRLREQGVLVSAIRPPTVPDGTA
RLRVTLSAAHAPEDVDALLAALGEAPSSQD
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaacctctgctttcgatcttgaaacggcgctggcggaacgccgacgcctgcat
cgctaccgtacgcgcctgaacactgatgcgccggccggtcgcgagacggtggttgatggc
cgccgctacctcaacttctgcgccaacgattatcttggtctggccaatcatccggatgtg
gtccaggcgctgaaacaggctgccgatgacattggtgtcggcagcggcgcatcgcatctg
gtgtgtggtcacagccgttttcaccacgcgctggaagaacagctggcggatgccactggc
cggccgcgcgcgctgctgttctccaccggcttcatggccaacctgggcgtggtgggggca
ttgctcgacaagcctgatgccgtgttcgaagacaaactcaatcacgcttccctgattgat
gccggtcttgccagcggcgcccgcttccgccgttatctgcacaacgatgccgacagcctc
gccgcacaactggcgcgcgccgacgcgcgccgcaaactcgtgatcaccgacggcgtgttc
agcatggacggcgatgccgcgccgctggccgcattgtgcgatgtggccgacgcgcatgac
gcctggatgatggtggacgatgcacacggcttcggtgtgctgggcgagcagggcgtcggt
acgccggcagcacaacaggtcgccgcgcgcattcccgtgtacatggccacgctcggcaag
gcactgggcaccttcggtgcctttgttgccggcagcgaagccctgatcgaaaccctgatt
caatttgcccggccctatatctacaccacggcgatgccgccggctgtcgcggcggcaacc
ttgaaaagcctggcgatcatgcgcacggaaacctggcgccgcgaaaaactggtggcgctg
attgctcagttccgtcgtggcgcccaggcgcagggctacacactgatggactccgccacg
ccgatccagccgctgcttatcggcgacgatgcggcggcgctgcaactcagcggacgtttg
cgcgaacagggtgttctggtgtcggccatccgcccgcccaccgtgccggacggcaccgcg
cgcctgcgggtgacgttgtccgccgcgcacgcacccgaagacgttgatgcattactggcg
gcgctcggtgaagcgccgtcttcacaggattaa

DBGET integrated database retrieval system