KEGG   Alcanivorax pacificus: S7S_01975Help
Entry
S7S_01975         CDS       T03580                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
apac  Alcanivorax pacificus
Pathway
apac00010  Glycolysis / Gluconeogenesis
apac00071  Fatty acid degradation
apac00350  Tyrosine metabolism
apac00625  Chloroalkane and chloroalkene degradation
apac00626  Naphthalene degradation
apac00680  Methane metabolism
apac01100  Metabolic pathways
apac01110  Biosynthesis of secondary metabolites
apac01120  Microbial metabolism in diverse environments
apac01200  Carbon metabolism
apac01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:apac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    S7S_01975
  09102 Energy metabolism
   00680 Methane metabolism
    S7S_01975
  09103 Lipid metabolism
   00071 Fatty acid degradation
    S7S_01975
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    S7S_01975
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    S7S_01975
   00626 Naphthalene degradation
    S7S_01975
Enzymes [BR:apac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     S7S_01975
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     S7S_01975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C TrkA_N 2-Hacid_dh_C PEP-CTERM
Motif
Other DBs
NCBI-ProteinID: AJD46817
UniProt: A0A0B4XK74
Position
410314..411423
Genome map
AA seq 369 aa AA seqDB search
MKSRAAIALEAGKPLTLTEIDVQDPKAGEVLVRIVATSVCHTDAYTLSGKDPEGLFPSVL
GHEGAGIVEAVGPGVTSLQPGDHVIPLYTAECGKCKFCLSGKTNLCGAVRATQGQGLMPD
GTSRFSLDGKTLHHYMGTSTFSEYTVLPEVSLAKVSKEAPLDKICLLGCGVTTGIGAVLN
TAKVEPGATVAVFGLGAIGLAVIQGSVMAKAARIIAIDVNPDKFELARQFGATDFVNPKD
YSDPIQQVIVDLTDGGVDYSFECIGNVNVMRSALECCHKGWGESIIIGVAGAGEEIATRP
FQLVTGRVWRGSAFGGVKGRSQLPGYVEQYMNGEIKIDEFITHDMPFDKINEAFDLLHEG
KSIRTVLHF
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcacgcgccgcgattgccctggaagccggcaagcccctgaccctgaccgagatt
gatgtgcaggacccaaaggccggtgaagtgctggtgcgcatcgtcgccaccagtgtctgc
cataccgatgcctacaccctgtccggcaaggacccggagggcctgttcccgtccgtgctc
ggtcacgaaggtgcgggcattgttgaagccgtggggccgggtgtgaccagcctgcaaccg
ggtgaccatgtgatcccgctgtacacggccgagtgtggcaagtgcaaattctgcctctcc
ggcaagaccaacctgtgcggcgccgtgcgggcgacacagggccagggcctgatgccggac
ggcacctcgcggttttcgctcgacggtaaaacactgcaccactacatgggcacctcgacg
ttttccgagtacaccgtgctgccggaagtgtcgctggcaaaagtctccaaagaggcgccg
ctggacaagatctgcctgctcggctgcggtgtcaccaccggcattggcgcggtgctcaac
accgccaaggtagagccgggcgcgacggtggccgtgttcggcctgggcgccatcgggctg
gcggtaatccagggttcggtcatggccaaggcggcgcgcatcattgccattgatgtgaac
ccggacaagttcgaactggcgcggcagtttggtgccacggatttcgtcaatccgaaggat
tacagcgatccgatccagcaggtgattgtcgacctgaccgacggcggtgtggattactcg
ttcgagtgcatcggcaacgtcaacgtgatgcgctccgcgctggagtgctgccacaagggc
tggggcgaatcgatcatcatcggtgtggcgggtgccggcgaggaaatcgccacgcggccg
ttccaactggtcaccgggcgcgtgtggcgcggctccgcctttggtggtgtaaagggccgc
agccagttgccgggctatgtggagcagtatatgaacggcgagatcaagatcgacgaattc
atcacccacgatatgccgttcgacaagatcaacgaggcgtttgatctgctgcacgaaggc
aagagcattcgcaccgtgctgcacttctga

DBGET integrated database retrieval system