KEGG   Alcanivorax pacificus: S7S_02225Help
Entry
S7S_02225         CDS       T03580                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
apac  Alcanivorax pacificus
Brite
KEGG Orthology (KO) [BR:apac00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    S7S_02225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 PMT_4TMC DUF5357
Motif
Other DBs
NCBI-ProteinID: AJD46867
UniProt: A0A0B4XKD6
Position
complement(468424..469689)
Genome map
AA seq 421 aa AA seqDB search
MDIIIANSTTILVLACAFGFLMAWGIGANDVANAMGTSVGSRALTVKQAIIIAIIFEAAG
AYLAGGEVTQTIRSGIVDSEVMADTPHLLVYGMMASLLAAGIWLVVASAFGWPVSTTHSI
VGAIVGFAAVGIGMDVVHWDKMGNIVASWVISPLFAGVISYALFRSVQKLILNTDDPYAQ
AKRYVPVYMFMTGFMVAMVTFTKGLKHVGLHMSTPASVLSAVIAGLVVAAVGATLLSRIK
PDAQAAKQFRFANVEKLFAVLMIFTACAMAFAHGSNDVANAVGPLAAIYSVVSTGGDVAA
QAAVPNWVLLLGAVGIVFGLAILGARVMSTVGSKITELTPSRGFAAELGAASTVVIASGI
GLPISTTHTLVGAVLGVGMARGISALNLRVISTIFTSWIVTLPAGAGLSILFFYMLTGIF
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggatatcatcatcgccaacagcaccaccattctcgtcctggcctgcgccttcggcttt
ctgatggcctggggcatcggcgccaacgacgtcgccaacgccatgggcacctcggtcggc
agccgtgcgctgaccgtgaagcaggcgatcatcatcgcgatcatctttgaagccgccggc
gcctacctggccgggggtgaagtgacccagaccatccgctccggcatcgtcgacagcgag
gtcatggcggacaccccccacctgctggtgtacggcatgatggcctcgttgctggccgcc
ggcatctggctggtagtggcgtccgccttcggctggccggtgtccaccacgcattcgatc
gtcggtgccatcgtcggcttcgcggcggtcggcatcggcatggacgtggtgcactgggac
aagatgggcaacatcgtcgccagctgggtgatctcgccgctgtttgccggggtcatttcc
tacgccctgttccgcagcgtgcagaagctgatcctcaacaccgatgacccgtatgcccag
gccaagcgctatgtgccggtctacatgttcatgaccggcttcatggtcgccatggtgacg
ttcaccaaggggctcaagcacgtcgggctgcacatgagcacgccggccagcgtgctgtcg
gcggtcattgccggcctggtagtggccgcggtcggtgcgaccctgctgtcccgcatcaag
cccgatgcgcaggcggcaaaacagttccgcttcgccaatgtggagaagctgttcgcggta
ctgatgatcttcaccgcctgtgccatggcctttgcccacggctccaatgacgtggccaac
gcggtcggcccgctggccgcgatctactcggtcgtgtccactggcggtgatgtggcggcc
caggcggcggtgccaaactgggtgctgttgctcggcgcggtggggatcgtgttcggcctg
gccatcctcggcgcccgggtcatgagcacggtcggcagcaagatcaccgagctgaccccg
agccgtggcttcgccgccgaactgggcgcggcctccaccgtggtgatcgcctccggtatc
ggcctgccgatctccaccacccacacgctggtgggggcggtgctcggggtcggcatggcg
cgcggcatcagcgcactgaacctgcgcgtgatcagcaccatcttcacctcctggatcgtg
accctgccggccggcgccggcctgtcgatcctgttcttctacatgcttaccggcatcttt
ggctga

DBGET integrated database retrieval system