KEGG   Alcanivorax pacificus: S7S_07070Help
Entry
S7S_07070         CDS       T03580                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
apac  Alcanivorax pacificus
Pathway
apac00620  Pyruvate metabolism
apac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    S7S_07070
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:apac02000]
    S7S_07070
Enzymes [BR:apac01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     S7S_07070
Transporters [BR:apac02000]
 Other transporters
  Primary active transporters [TC:3]
   S7S_07070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 RnfC_N GCV_H PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: AJD47830
UniProt: A0A0B4XMF2
Position
1573271..1575046
Genome map
AA seq 591 aa AA seqDB search
MSEKKPLGITDVVLRDAHQSLFATRLRIDDMLPIAGKLDQVGFWSLESWGGATFDACIRY
LGEDPWDRIRELKKAMPNTPQQMLLRGQNLLGYRHYADDVVDKFVERAAVNGVDVFRVFD
AMNDMRNIRRAIEAVLRQDRHAQGTISYTVSPVHTLDMWVDLAKQVEDMGAHSVCIKDMA
GLLRPYVAFELVSRLKATLSIPVHMQCHATTGLSTATALKAAEAGIDNVDTAISSMSMTY
GHSPTEAVVAILEGTERDTGLDIHLLEDIAAYFREVRKKYAKFEGSLRGVDSRILVAQVP
GGMLTNMESQLREQNAADRLDEVLEEIPRVREDLGFIPLVTPTSQIVGTQAVLNVLAGER
YKALSKETRGVLRGEYGAAPAPFNATLQARALDGDAPVTGRPADLIDDEMDRLSTELDSV
AAEKGITLADGERRIDDVLTYALFPQIGLKFLQHRGDASAFEPAPTGREGSVVTSDDGEE
IYTVKVEGREYTVTVSNGGDITGVKTIGGAAPATGAAPAGDGEPVPSPLAGNIFKVLVKP
GQAVQEGEKIMVLEAMKMETDISAPRAGTITAINVKEGDAVTVGDALVNIA
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagaaaaaaccgcttggcattaccgatgtggtgctgcgcgacgcgcatcaatcg
ctgttcgccacccggttacggatcgacgacatgctgccgattgccggcaagctggaccag
gtgggtttctggtcgctcgaatcctggggcggcgccactttcgatgcctgtatccgctat
ctcggcgaggacccctgggaccgcatccgtgaactcaagaaggcgatgccgaacacgccg
cagcagatgctgttgcgtggccagaacctgctcggttaccgccattacgccgacgacgtg
gtggacaagttcgttgaacgtgctgcggtcaatggtgtggatgtgttccgcgtgttcgat
gccatgaacgacatgcgcaatatacgccgtgccattgaggcggtgttgcggcaggaccgt
cacgcgcagggcaccatctcctacacggtaagcccggtgcacaccctcgacatgtgggtt
gacttggcgaaacaggtcgaggacatgggcgcgcattcggtctgcatcaaggacatggcc
gggctgcttcggccgtatgtggcgttcgaactggtgtcgcggctgaaagcgacgctgtcg
atcccggtgcacatgcagtgccacgccaccaccggtttgtcgacggccaccgcgctcaag
gcggcggaagcgggcattgataacgtggacacggcgatttcctccatgtcgatgacctac
ggccacagcccgacggaagcggtggtggcaatcctcgaagggacggagcgtgataccggc
ctggatattcatctgctggaagacatcgcggcctatttccgcgaggtgcgcaaaaagtac
gcgaaattcgaaggcagcctgcgcggtgtggactcccgcattctggtggcccaggtgccc
ggcggcatgctgaccaacatggaaagccagctgcgcgaacagaacgcggcggatcgcctc
gacgaagtgctggaagaaatcccgcgcgtgcgcgaggacctgggctttattccgctggtg
acaccgacctcgcagatcgtcggcacccaggcggtgctgaacgtgctggccggtgagcgc
tacaaggcgctgtcgaaggaaacccgtggcgtgctgcgtggcgaatacggtgcagcaccc
gcgccgttcaatgccacgttgcaggcgcgcgcgctggatggtgatgcaccggtgaccggc
cgcccggcggacctgattgacgacgagatggacaggctcagcacggagctggacagcgtt
gccgcagaaaaaggcatcacgctggcggacggcgagcgtcgtatcgacgacgtactcact
tacgccctgttcccgcagatcggcctgaaattcctgcaacaccgtggcgatgccagcgcc
tttgagccggcgcctaccggccgcgaggggagtgtggtgaccagcgatgacggcgaagaa
atctataccgtcaaagtggagggccgcgaatacacagtgaccgtcagtaacggcggcgac
atcaccggcgtgaaaacgatcggcggggccgcgcccgccaccggcgctgcccccgccggt
gacggcgaacccgtgccgtcgccgctggccggcaatatcttcaaggtactggtgaaaccc
ggccaggccgtccaggaaggcgaaaagatcatggtgctggaagccatgaaaatggaaacc
gatatttcagcaccgcgcgccggcaccattacggcgatcaacgtcaaggaaggcgatgcg
gtgacggtgggcgatgccctggtgaacatcgcctga

DBGET integrated database retrieval system