KEGG   Alcanivorax pacificus: S7S_13090Help
Entry
S7S_13090         CDS       T03580                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
apac  Alcanivorax pacificus
Pathway
apac00071  Fatty acid degradation
apac00072  Synthesis and degradation of ketone bodies
apac00280  Valine, leucine and isoleucine degradation
apac00310  Lysine degradation
apac00362  Benzoate degradation
apac00380  Tryptophan metabolism
apac00620  Pyruvate metabolism
apac00630  Glyoxylate and dicarboxylate metabolism
apac00640  Propanoate metabolism
apac00650  Butanoate metabolism
apac00900  Terpenoid backbone biosynthesis
apac01100  Metabolic pathways
apac01110  Biosynthesis of secondary metabolites
apac01120  Microbial metabolism in diverse environments
apac01130  Biosynthesis of antibiotics
apac01200  Carbon metabolism
apac01212  Fatty acid metabolism
apac02020  Two-component system
Brite
KEGG Orthology (KO) [BR:apac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    S7S_13090
   00630 Glyoxylate and dicarboxylate metabolism
    S7S_13090
   00640 Propanoate metabolism
    S7S_13090
   00650 Butanoate metabolism
    S7S_13090
  09103 Lipid metabolism
   00071 Fatty acid degradation
    S7S_13090
   00072 Synthesis and degradation of ketone bodies
    S7S_13090
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    S7S_13090
   00310 Lysine degradation
    S7S_13090
   00380 Tryptophan metabolism
    S7S_13090
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    S7S_13090
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    S7S_13090
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    S7S_13090
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:apac04147]
    S7S_13090
Enzymes [BR:apac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     S7S_13090
Exosome [BR:apac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   S7S_13090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJD49030
UniProt: A0A0B4XQH2
Position
complement(2971253..2972539)
Genome map
AA seq 428 aa AA seqDB search
MLAASKVRRVAIIGGNRIPFARSNTAYFGVSNQDMLTAALQGLVQRFNLKGERIGEVAAG
AVMKHSRDFNLVRECVLSSGLAPETPAYDLQQACGTGLEAALLVANKIALGQIDSGIAGG
VDTTSDAPLGVNDEKRKVFMAINRAKTNGEKAKLALKLLNPKWFLPDIPKNAEPRTGLAM
GDHAAITAVEWGVTREAQDKLALASHKNLAKSYEDGWQKDLISPFKGLERDNNLRGDSTL
EKLSSLKPVFGGPEGTMTAANSTPLTDGASAVLLASEEWAKERGLPVLAYLTLGEAAAVD
FVNKKEGLLMAPAYAVPSMLDKLNLTLQDFDFYEIHEAFASQVLATLKAWEDENFCKTRL
GRDKALGSIDMSKLNVKGSSLAAGHPFAATGGRILANAAKLLNEKGSGRCLISICAAGGQ
GVVAVLEK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgttagcagccagtaaagtacgtagagtggccatcatcggtggcaaccggattccgttc
gcacgcagcaacaccgcctatttcggtgtgtccaaccaggacatgctgactgccgccctg
cagggcctggtacagcgtttcaacctcaagggcgaacgcatcggtgaggtggccgctggc
gcggtgatgaagcactcgcgcgatttcaacctggtgcgcgaatgcgtgctcagctccggc
ctggcgccggaaaccccggcctatgatctgcaacaggcctgcggcaccggcctggaagcg
gcgctgctggtggcgaacaagatcgccctgggccagatcgacagcggtattgccggtggc
gtggacaccacctccgatgcgccgctgggcgtcaacgacgagaagcgcaaggtgttcatg
gccatcaacagggccaagaccaatggcgagaaagccaagctggcgctgaaactgctgaac
ccgaaatggttcctgccggatatcccgaaaaacgccgagccgcgcacgggcctggcgatg
ggtgaccacgccgcgatcacggcggtcgagtggggtgtgacccgcgaagcgcaggacaag
ctggcgctggcctcgcacaagaacctggccaaatcctatgaagacggctggcagaaagac
ctgatctccccgttcaagggcctggagcgcgacaacaacctgcgcggcgattccaccctg
gaaaaactctccagcctgaagccggtattcggcggcccggaaggcaccatgacggcggcc
aactccacaccgctgaccgacggcgcctccgccgtgctgctggcgtcggaagagtgggcc
aaagagcgtggcctgccggtactggcctacctcacactgggcgaagcggcggccgttgat
ttcgtcaacaagaaggaaggcctgctgatggcaccggcctacgccgtgccgagcatgctc
gacaagctgaacctgacactgcaggacttcgatttctacgagatccacgaagccttcgcc
tcgcaggtgctggcgacgctgaaagcctgggaagacgagaacttctgcaaaacccgcctc
ggccgcgacaaggccctgggcagcatcgacatgagcaagctgaatgtgaaaggcagctcg
ctggcagcgggccacccgttcgctgccaccggcggccgcatcctggccaacgcggccaag
ctgctgaacgaaaaaggctccggccgctgcctgatttccatctgcgcggcaggtggtcag
ggtgtggtagcggtactggaaaaataa

DBGET integrated database retrieval system