KEGG   Alcanivorax pacificus: S7S_14930Help
Entry
S7S_14930         CDS       T03580                                 

Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
apac  Alcanivorax pacificus
Brite
KEGG Orthology (KO) [BR:apac00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    S7S_14930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AJD49398
UniProt: A0A0B4XSJ7
Position
3347887..3348327
Genome map
AA seq 146 aa AA seqDB search
MPMKPSDTPLHAGGPLTPPTPDNPHYHVEVQVESEFLPDQSDTEGHRWVFAYHITIRNHG
DMAAQLLTRHWVITDAEERVQEVHGEGVIGEQPRLAPGQSFSYTSGAVLETSIGSMYGSY
QMLAEDGTCFDAAIPAFTLAPPLALH
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgccgatgaagcccagcgatacccccctgcacgccggtggccccctgacgccacccacc
cccgacaacccgcattaccacgtcgaggtgcaggtggagagcgaattcctgccggaccag
agcgacacggaaggccaccgctgggtgttcgcctaccacatcaccatccgcaaccacggc
gacatggccgcacagctgctgacccgccactgggtcatcaccgatgccgaggaacgggtg
caggaagtgcacggtgaaggcgtgatcggcgagcaaccacggctggcgcccggccagagc
ttctcctacaccagcggcgccgtgctcgaaacctccatcggcagcatgtacggcagctac
cagatgctggccgaggacggcacctgcttcgacgccgccatccccgccttcaccctggcg
ccaccgctggccctgcattga

DBGET integrated database retrieval system