KEGG   Avibacterium paragallinarum: EIA51_00690Help
Entry
EIA51_00690       CDS       T05728                                 

Gene name
nadR
Definition
(GenBank) multifunctional transcriptional regulator/nicotinamide-nucleotide adenylyltransferase/ribosylnicotinamide kinase NadR
  KO
K06211  HTH-type transcriptional regulator, transcriptional repressor of NAD biosynthesis genes [EC:2.7.7.1 2.7.1.22]
Organism
apag  Avibacterium paragallinarum
Pathway
apag00760  Nicotinate and nicotinamide metabolism
apag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apag00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    EIA51_00690 (nadR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:apag03000]
    EIA51_00690 (nadR)
Enzymes [BR:apag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.22  ribosylnicotinamide kinase
     EIA51_00690 (nadR)
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     EIA51_00690 (nadR)
Transcription factors [BR:apag03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    EIA51_00690 (nadR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_28 HTH_3 CTP_transf_like HTH_26 HTH_31 HTH_19 MSV199 FAD_syn HTH_37 DUF1351
Motif
Other DBs
NCBI-ProteinID: AZI13288
UniProt: A0A3G8WB00
Position
139396..140667
Genome map
AA seq 423 aa AA seqDB search
MSSFAYLQQKRKQLHLKVSEVCEQANITRAYFNQLVSGKIKNPSAAKLSALHKVLQITEQ
LDKKVGVIFGKFYPVHTGHINMIYEAFSKVDEVHVVVCSDTERDLKLFYDSKMKRMPTVQ
DRLRWMQQIFKYQKNQIVIHHLVEDGLPSYPNGWEAWAERVKQLFNEKNVNPSVVFSSEP
QDKAPYEKYLNLQVELVDPQRQFFNVSATKIRNNPFHYWKFIPKEVRPFFAKTIAILGGE
SSGKTVLVNKLATVFNTTSAWEYGREFVFEQLGGDEQAMQYSDYPQMALGHQRYIDYAVR
HAHKVAIVDTDFITTQAFCIQYEGKAHPFLDSMIKEYPFDITILLNNNTKWVDDGLRSLG
SHKQRQRFQQLLKKLLDKYNVPYIEIESPSYLERYNKVKEIVEKILNEEELPELIHDKLL
FEE
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtctagtttcgcctatttacaacaaaaacgaaaacaacttcatttaaaagtaagcgaa
gtttgcgaacaagccaatattacgcgtgcttattttaatcagctagttagtggcaaaatt
aaaaatccgagtgctgcaaagctttcggcactgcataaggtactacaaattactgaacag
ctagataaaaaagtaggtgtcatttttggcaaattttaccctgttcacacagggcatatt
aatatgatttatgaggctttcagtaaggttgatgaagttcacgttgtggtgtgtagtgat
acggagcgggatctcaaactcttttatgatagcaaaatgaagcgaatgccaacggtgcaa
gatcgtctgcgttggatgcaacaaatctttaaataccagaaaaatcaaattgttattcat
cacctagtggaagatggtttaccgagttacccaaatggatgggaagcttgggcagagcgg
gtaaagcaattgtttaacgagaagaatgttaatccaagtgtcgtatttagcagtgaacct
caagataaagccccttacgaaaagtatttgaatctgcaggtagaattggttgatccacag
cgtcaattttttaatgtgtctgccactaaaattcgtaataatcctttccattattggaaa
tttattccgaaagaagtgcgtccatttttcgccaaaaccattgcgattttaggtggagaa
agcagtggtaagacagtattagtgaataaattggcgaccgtttttaatactacgtccgcg
tgggaatatggtcgagagtttgtgtttgaacagcttggtggtgatgagcaagcgatgcaa
tattctgattacccacaaatggcactgggacatcaacgttatattgattatgcagttcgc
cacgctcataaagtggcgattgtggatacagatttcattactacgcaagcattttgcatt
caatatgaaggcaaagcccacccatttttagattcaatgattaaagaatatccgtttgat
attaccattctactgaacaacaacactaaatgggttgatgatggattgcgtagtttaggt
agtcacaagcaacggcaacgtttccaacagttattgaaaaaacttttggataaatataat
gtgccttatatcgaaattgaatcgccaagttatctagaacgctacaataaagtgaaagag
attgtggaaaaaattctcaacgaagaagaattgcccgagctaattcacgataaattgctt
tttgaggaataa

DBGET integrated database retrieval system