KEGG   Avibacterium paragallinarum: EIA51_02470Help
Entry
EIA51_02470       CDS       T05728                                 

Definition
(GenBank) glutamate--tRNA ligase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
apag  Avibacterium paragallinarum
Pathway
apag00860  Porphyrin and chlorophyll metabolism
apag00970  Aminoacyl-tRNA biosynthesis
apag01100  Metabolic pathways
apag01110  Biosynthesis of secondary metabolites
apag01120  Microbial metabolism in diverse environments
Module
apag_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:apag00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EIA51_02470
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EIA51_02470
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:apag01007]
    EIA51_02470
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:apag03016]
    EIA51_02470
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:apag02048]
    EIA51_02470
Enzymes [BR:apag01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     EIA51_02470
Amino acid related enzymes [BR:apag01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   EIA51_02470
Transfer RNA biogenesis [BR:apag03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    EIA51_02470
 Prokaryotic type
   Other AARSs
    EIA51_02470
Prokaryotic defense system [BR:apag02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    EIA51_02470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c ARL2_Bind_BART
Motif
Other DBs
NCBI-ProteinID: AZI13603
UniProt: A0A3G8WDU2
Position
complement(464055..465497)
Genome map
AA seq 480 aa AA seqDB search
MKAEPLFNLDPAVKVRTRFAPSPTGYLHVGGARTALYSWLFAKHNQGEFVLRIEDTDLER
STPEATQAILEGMEWLNLAWEHGPYYQTKRFDRYNQVIDQMLEQGLAYRCYCSKERLENL
RNEQEKNKEKPRYDGYCLHHQPEDPNAPHVVRFKNPKEGSVIFDDAVRGRIEISNSELDD
LIIRRTDGSPTYNFCVVIDDWDMGITHVVRGEDHINNTPRQINILKALNAPIPTYAHVSM
ILGDDGQKLSKRHGAVSVMQYRDDGFLPEALLNYLVRLGWGHGDQEIFSVEEMIKLFELT
QVSKSASAFNTEKLLWLNHHYIRELPPEYVAEHLKWHYQHQGIDTHNGPPLTDIVVMLRE
RCKTLKEMAASSRYFFEDVEHFEESAVKKHFKSTAVEALEKVYEKLTALSQWTAEPIHQA
IEQAAEELGVGMGKVGMPLRVAVTGSGQSPSMDVTLVGIGRKRTLARIQKAIAFIKSQAA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgaacccttatttaatttagatcctgcggtaaaagtccgcacgcgttttgca
ccaagcccaacaggctatttacacgttggcggtgcgagaaccgccctgtattcttggtta
tttgctaaacataaccaaggagaatttgttttacgcattgaagatacagatttagaacgt
tcaaccccagaagccactcaagccattttggaaggaatggaatggctgaatttagcttgg
gaacacgggccttattaccaaaccaaacgttttgatcgctacaatcaagttatcgatcaa
atgcttgagcaaggcttagcttaccgttgttattgcagtaaagaacgtttagaaaactta
cgcaacgaacaagaaaaaaacaaagaaaaaccgcgttatgatggctattgtttacatcat
cagccagaagatccgaatgccccacacgttgtgcgttttaaaaatcctaaagaaggatcg
gtgatttttgatgatgcggtacgtggacgcattgagatcagcaacagcgagcttgatgat
ttaatcattcgccgtacagatgggtcgccaacctacaatttctgcgtggtgattgatgac
tgggatatgggcatcacccacgttgtgcgtggtgaagatcacatcaataacacaccacgc
caaattaatattctcaaagcgttaaatgcccctattccaacctacgctcacgtttcgatg
atcttaggtgatgatgggcaaaaactctctaaacgccacggtgcggtgagtgtaatgcaa
tatcgcgacgacggtttcttgcctgaagccttgctaaattatttagtacgtctaggctgg
ggacacggcgaccaagaaattttctccgtcgaagaaatgatcaaactctttgagctcacc
caagtgagtaaatccgcaagtgcgttcaacacggaaaaattattatggctcaaccatcat
tatatccgtgaactcccgccagaatatgtcgcggagcatctaaaatggcactatcaacat
caaggcattgatacgcacaacggcccaccattaacggatattgtggtgatgctaagagaa
cgttgcaaaaccctcaaagaaatggcagcctccagccgctacttctttgaagacgttgag
cattttgaagaaagtgcggtgaaaaaacatttcaaatctaccgccgtagaagccttagaa
aaagtgtatgaaaaactgaccgcactttctcaatggacagcagaacccatccaccaagct
attgaacaagccgccgaagaacttggcgtaggaatggggaaagtgggaatgccattgcga
gttgcggtaactggctctggacaatccccctcaatggacgtaacccttgtcggcattgga
cgcaaacgcactttagcacgcattcaaaaagccattgcgtttattaaatcgcaagccgct
taa

DBGET integrated database retrieval system