KEGG   Avibacterium paragallinarum: EIA51_09805Help
Entry
EIA51_09805       CDS       T05728                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
apag  Avibacterium paragallinarum
Pathway
apag00051  Fructose and mannose metabolism
apag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    EIA51_09805
Enzymes [BR:apag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     EIA51_09805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh Sacchrp_dh_NADP IcmF-related UDPG_MGDP_dh_N F420_oxidored DUF4073 3HCDH_N CDI NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: AZI14869
UniProt: A0A3G8W237
Position
complement(2067166..2068317)
Genome map
AA seq 383 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADSGIEVIFADVNDDVIRLLQEQKSYNVKVVGETVNRIEQ
VSNVTGVNSKDENALIDLFKQVDLVTTAVGPNVLKIIASTIAKGLVARLEAGNKQPLNII
ACENMVRGTTFLKEQVFHYLDEKQQQQVDALVGFVDSAVDRIVPPVQLDPQDPLLVTVEE
FSEWIVDKTQFKGDIPHIEGMELTDNLMAFVERKLFTLNTGHAVTAYYGKLKGYQFVKES
IEDPQVRAFVKAVMEESGAVLIKRYGFDPQAHATYIEKILARFANPYLVDDVDRVGREPL
RKLSYNDRLIKPLRGTLEYHLPHQHLMQAVATALCYRNENDPQAQELQQALAQQGVIPSL
EKFTELPDHEVISQIAQAYEKLA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggggcaggaaatatcggacgaggtttcatcggaaaattgctc
gcagacagtggtattgaagtgatttttgccgatgtgaatgatgatgttattcgattatta
caagaacaaaaaagctacaacgtaaaagtggtgggggaaacggttaatcgaattgagcag
gtgtctaatgtaacaggcgttaattcaaaagatgaaaatgctctgattgacttatttaaa
caagtggatttagtcaccactgccgttggaccaaacgtactaaaaattattgctagcacc
attgccaaaggcttggtagcacgtcttgaagcaggcaacaaacagccactcaatatcatt
gcgtgcgaaaatatggtgcgtggcacaaccttcttaaaagagcaggtttttcactattta
gatgaaaaacagcagcaacaagtggacgcattggttggctttgtggatagtgcggtggat
cgcattgtgccgccagtgcaacttgatccgcaagatccgctgttggttacggtggaagaa
tttagcgaatggatcgtggataaaacccaattcaaaggcgatattccgcacattgaggga
atggaactcacggataatctaatggcgtttgtagaacgtaaattgtttacgctaaataca
ggccacgcggtaacggcatattacggcaaattaaaaggctaccaatttgtcaaagaaagc
attgaagatccgcaagtgcgtgcttttgttaaagcagtaatggaagaaagtggcgcagtt
ctgattaaacgttacggatttgatccgcaagcacacgccacttatattgaaaaaatcttg
gctcgatttgccaatccttatttagttgatgatgtggatcgtgtaggacgtgagccgttg
aggaaactgagctacaacgatcgtttgattaaaccattgcgtggcacattggaataccat
ttgcctcatcaacaccttatgcaagcagttgccaccgccctgtgctatcgcaatgaaaac
gatccgcaagcccaagagttgcaacaagccctcgctcagcaaggggttattccaagcctt
gagaaattcacggaattgccagatcacgaagtgatttcacaaatcgcccaagcctatgaa
aaactcgcgtaa

DBGET integrated database retrieval system