KEGG   Aeribacillus pallidus: AP3564_02110Help
Entry
AP3564_02110      CDS       T04993                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
apak  Aeribacillus pallidus
Pathway
apak00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:apak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AP3564_02110
Enzymes [BR:apak01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AP3564_02110
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AP3564_02110
    1.1.1.-  
     AP3564_02110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc TrkA_N 2-Hacid_dh_C F420_oxidored BRCA2
Motif
Other DBs
NCBI-ProteinID: ASS89223
UniProt: A0A223E1X3
Position
459161..460213
Genome map
AA seq 350 aa AA seqDB search
MKAARWHNARDIRVEEVEEPKAGKGKVKIKVEWAGICGSDLHEYAAGPIFVPVQEPHPVS
KDVAPIIMGHEFSGQVVEVGEGVTKVKVGDPVVVEPILRCGECPACKKGKYNLCESLGFH
GLSGGGGGFSEYTVVDEHMVHKMPEGLSYEQGALVEPAAVALHAVRLSKIKPGDKAAVFG
TGPIGLLVIEALKAAGAAEIYAVEVSKERLQKAKELGATSVINPIEEDPVQKLHELTDGG
VDVAFEVTGIPAVLQQAIDSTAFEGETVIVSIWEKEAGIQPNNIVLKERNVKGIIAYRDI
FPAVMELMKRGYFQAEKLVTKRIKLDDIVAEGFETLIKEKDQVKILVKPE
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcaagatggcacaacgctagagacattcgagtagaggaagtagaagaaccg
aaagcagggaaaggaaaagtaaaaattaaagtagaatgggcaggaatttgcggaagcgat
ttacacgaatatgcggcaggtccaatttttgttcctgttcaagagcctcatcctgtcagt
aaagatgtggcgccaattatcatgggccacgaattttctggccaagtagttgaagttgga
gaaggcgttacaaaagtaaaggttggggatcctgtcgttgtagaacctattcttcgctgt
ggtgaatgcccagcttgtaaaaaaggtaagtacaatctttgcgaatctttaggattccac
ggtttatccggtggcggcggcggattctctgagtatactgtcgttgatgagcatatggtg
cataaaatgcctgaaggtctttcttatgaacaaggagcattggtggagcctgcggctgta
gccttgcatgctgttagattaagcaaaatcaaacctggcgataaagccgctgtgtttgga
acaggtcctataggtcttcttgtgattgaagcattaaaagcagctggcgctgcagaaatt
tatgcagtagaagtttccaaagaacgtttgcaaaaagcgaaagaactcggtgctacatct
gtcatcaatccaatagaggaagatccggttcaaaagcttcatgaattaaccgatggcgga
gtcgacgttgcgtttgaagtaacgggaataccggctgttttacaacaagctattgacagc
actgcatttgaaggagaaacagtcatcgttagcatatgggaaaaagaagcgggcattcag
ccaaataatatcgtattaaaagaaagaaatgtaaaaggaattattgcataccgcgatatc
ttccctgctgtaatggaattaatgaaacgaggctacttccaagcagaaaaactcgttacg
aaacgaattaagctagatgatattgtagcagaaggatttgaaacgctgataaaagaaaaa
gaccaagtgaaaattttggtaaaaccagaataa

DBGET integrated database retrieval system