KEGG   Aeribacillus pallidus: AP3564_02780Help
Entry
AP3564_02780      CDS       T04993                                 

Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
apak  Aeribacillus pallidus
Pathway
apak00561  Glycerolipid metabolism
apak00640  Propanoate metabolism
apak01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AP3564_02780
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    AP3564_02780
Enzymes [BR:apak01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     AP3564_02780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase Polysacc_deac_2 PFK DegS
Motif
Other DBs
NCBI-ProteinID: ASS89318
UniProt: A0A223E238
Position
complement(587787..588899)
Genome map
AA seq 370 aa AA seqDB search
MAAERVFISPAKYVQGKNVITKIANYLEGIGNKTVVIADEIVWKIAGHTIVNELKKGNIA
AEEVVFSGEASRNEVERIANIARKAEAAIVIGVGGGKTLDTAKAVADELDAYIVIVPTAA
STDAPTSALSVIYSDDGVFESYRFYKKNPDLVLVDTKIIANAPPRLLASGIADALATWVE
ARSVIKSGGKTMAGGIPTIAAEAIAEKCEQTLFKYGKLAYESVKAKVVTPALEAVVEANT
LLSGLGFESGGLAAAHAIHNGFTALEGEIHHLTHGEKVAFGTLVQLALEEHSQQEIERYI
ELYLSLDLPVTLEDIKLKDASREDILKVAKAATAEGETIHNAFNVTADDVADAIFAADQY
AKAYKEKHSK
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagaaagagtatttatcagccctgctaaatatgttcaaggtaaaaatgtcatt
acaaaaatcgcgaattatcttgaaggaattggaaacaagacagtcgtgatagctgatgaa
atagtttggaaaatagctgggcatacaatcgtaaacgaattaaaaaaaggaaatattgca
gccgaagaagtagtttttagcggagaagcttcgagaaacgaggtagaaagaatcgcgaat
attgcaagaaaagcagaagctgctattgtaatcggcgttggtggaggaaaaacgttagat
accgcaaaagcggtagcggatgaattagatgcttatatagtgattgtgccgacagctgct
tcaactgatgctccaactagtgctctttctgttatatattctgatgacggcgtatttgaa
agctaccgtttttataaaaagaatccagatcttgtacttgtcgatacgaaaattatcgcc
aatgctccgccacgtttacttgcctctggaatcgctgatgcacttgcaacttgggtggaa
gcacgcagtgttataaaatccggaggaaaaacgatggcgggcggtatccctacaattgca
gctgaagcaattgcagaaaaatgtgaacaaactttattcaagtacgggaagcttgcctat
gaatcagtaaaagcaaaagtcgtcacccctgcgttagaagcggtcgtcgaagcaaacacg
ctccttagcggactaggttttgaaagcggcggtttggcagcggctcatgctattcataac
ggatttaccgcgttagaaggcgaaatacatcatttgacacacggagagaaagtggcattt
ggtactcttgtccagctcgctctcgaagaacattcacaacaagaaattgaacgctatatc
gagctttatttgagccttgatttgccagtcacgttggaggacattaaattaaaagatgct
tcacgcgaagatatactaaaagtcgctaaagcagcaaccgcagaaggggaaacaatccat
aatgcattcaatgtgacagctgatgatgtagcagatgcgatttttgctgctgatcaatat
gcgaaagcatataaagaaaaacacagcaaataa

DBGET integrated database retrieval system