KEGG   Aeribacillus pallidus: AP3564_02815Help
Entry
AP3564_02815      CDS       T04993                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
apak  Aeribacillus pallidus
Pathway
apak00071  Fatty acid degradation
apak00072  Synthesis and degradation of ketone bodies
apak00280  Valine, leucine and isoleucine degradation
apak00310  Lysine degradation
apak00362  Benzoate degradation
apak00380  Tryptophan metabolism
apak00620  Pyruvate metabolism
apak00630  Glyoxylate and dicarboxylate metabolism
apak00640  Propanoate metabolism
apak00650  Butanoate metabolism
apak00900  Terpenoid backbone biosynthesis
apak01100  Metabolic pathways
apak01110  Biosynthesis of secondary metabolites
apak01120  Microbial metabolism in diverse environments
apak01130  Biosynthesis of antibiotics
apak01200  Carbon metabolism
apak01212  Fatty acid metabolism
apak02020  Two-component system
Brite
KEGG Orthology (KO) [BR:apak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AP3564_02815
   00630 Glyoxylate and dicarboxylate metabolism
    AP3564_02815
   00640 Propanoate metabolism
    AP3564_02815
   00650 Butanoate metabolism
    AP3564_02815
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AP3564_02815
   00072 Synthesis and degradation of ketone bodies
    AP3564_02815
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AP3564_02815
   00310 Lysine degradation
    AP3564_02815
   00380 Tryptophan metabolism
    AP3564_02815
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AP3564_02815
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AP3564_02815
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AP3564_02815
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:apak04147]
    AP3564_02815
Enzymes [BR:apak01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AP3564_02815
Exosome [BR:apak04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AP3564_02815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ASS89325
UniProt: A0A223E2E1
Position
596187..597335
Genome map
AA seq 382 aa AA seqDB search
MTIPVIVMAKRTAIGKMGGMFKNVRPEQLAAAVIKAVVDESGIDPQEIDEVILGNAVGPG
GNIARLSLLLAGLPDQVPGITVDRQCGSGLEAVNLACRLVQSGAGDIYIAGGVESTSLAP
WKIEKPLSLYEMKPPKIYTRARFSPESFGDPEMGEAAENVAEAFQISREEQDLFAYSSHQ
KAVQAMENDRFSSEIVPVNGMDRDECPRKRLSLERLRAMKPIFKENGTVTVGNSCPLNDG
ACAVLVMSEKKCRELGLLPVLKFVDCTSAGVDPNLLGIGPVPAVQQLLKRTGLQMEDIDL
IEFNEAFASQVLASVKQLNIPLEKLNVGGGAIAIGHPYGASGAILVARLCTEMKRLRGKR
AIATLGIAGGLGLATLFELYDG
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgacgatccctgtcattgttatggcaaaaagaacggctattggaaaaatggggggaatg
tttaaaaacgtccgccctgaacaactggctgctgcagtcatcaaagcggttgtagacgag
agcggaattgatccgcaggaaattgatgaagttattttaggaaatgcggtcggtccagga
ggaaatatcgctagactctcactccttttagcggggcttcccgatcaagttccgggtatt
actgttgatcgccaatgcggatcaggattggaagcggtgaatctcgcttgccggcttgtc
caatcaggagccggcgacatttatattgccggaggagtcgaaagtacaagccttgcccct
tggaaaattgaaaaacctttatctttatatgaaatgaagccacctaagatctatacgaga
gcacggttttcaccggagtcgttcggtgatcctgaaatgggggaagcggcggaaaatgtt
gcggaagcgtttcaaatttcaagggaagagcaggacttgtttgcatacagcagccatcaa
aaagcggttcaagcgatggagaatgacagattcagcagtgaaattgtccctgtaaatggc
atggatcgtgatgaatgtccaaggaaaaggttgagcttggaaaggcttcgtgccatgaag
ccgatatttaaagaaaatggcacagtgactgttggcaattcttgtccattgaacgacggg
gcttgtgccgtccttgtcatgtctgaaaaaaaatgccgagagcttgggcttctgcccgtt
ctgaaatttgtcgattgtacaagtgcaggtgtcgatccgaaccttttaggcattggtcct
gttccagcagtgcaacagctgctgaaacgaaccggcttgcaaatggaggatatcgattta
atcgaatttaatgaagcctttgcctctcaagtattggcttctgttaagcaattaaacatc
ccattggaaaagctgaatgtgggaggaggggctattgccatcggacatccttatggtgct
tcaggcgctattcttgttgcaaggctttgcacagaaatgaaaagattgagaggcaaacgg
gcaatcgcaacattaggaatcgcaggtggtctgggcctcgctacattgtttgaattgtat
gacggataa

DBGET integrated database retrieval system