KEGG   Aeribacillus pallidus: AP3564_04965Help
Entry
AP3564_04965      CDS       T04993                                 

Definition
(GenBank) hydroxyglutarate oxidase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
apak  Aeribacillus pallidus
Pathway
apak00310  Lysine degradation
apak01100  Metabolic pathways
apak01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:apak00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    AP3564_04965
Enzymes [BR:apak01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     AP3564_04965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Mqo Pyr_redox_3 NAD_binding_8 Pyr_redox_2 Thi4 FAD_binding_2 Lycopene_cycl Trp_halogenase DUF3198 NAD_binding_9 HI0933_like Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ASS89690
UniProt: A0A161ZRU5
Position
complement(1052851..1054047)
Genome map
AA seq 398 aa AA seqDB search
MYDYVIVGGGIVGLSTALAIYEQHPNAKVAIIEKENKVASHQTGHNSGVIHSGIYYKPGS
YKAQLAKKGNQAMIMFCQKYDIPYEVCGKVIVASDEHEREELEKLFQRGLKNGLNIRKIS
KEELHEFEPYVNGIEAIHVPSTGIVNFRLVSERMADLILEKGGEIFLNEKVEVIHEKKQE
VIVETANKTFQSRFFINCAGLNSDRIAKIANLYTDVKIVPFRGEYYMLNPQKSYLVKNLI
YPVPNPNFPFLGVHFTRMIDGSIDIGPNAVLSLKREGYKKSDANMKDLFEVLTFPGFWKL
AGQYMKEGLEEMIRSMSKKKFVENVQKLMPDITEEDLLPGPSGVRAQALSKDGALIDDFY
IVPTKRSIHVLNAPSPAATASIEIGRTIAKQMIQRQPI
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtatgattatgtaattgtcggcggaggaatagtcggcttatccactgcattggcaata
tatgaacaacacccaaacgcaaaagtggcaataatcgaaaaagaaaataaagttgcctcc
catcaaacgggtcataacagcggggtgatccattccggtatatattacaagcccgggagc
tataaggcgcagcttgcgaaaaaaggtaatcaggcaatgatcatgttttgccaaaaatac
gatatcccttatgaagtctgcggcaaagtaatcgttgccagcgatgaacatgagcgggag
gagcttgagaagctgttccaacgcggattaaaaaacggcctcaatatccggaaaatttca
aaggaggagcttcatgaatttgaaccttatgtgaatggaatagaagccattcatgttcca
tcaacaggtattgtaaatttccgtcttgttagtgaacggatggcagatttaatcctcgaa
aagggcggggagatctttttaaacgaaaaagtagaagtgattcatgaaaaaaaacaagaa
gttatcgttgaaacagcaaacaaaacctttcaaagccgattttttataaattgtgcagga
cttaacagcgatcgtattgctaaaatagcaaatctgtatacggatgtgaaaattgttcca
ttccgtggagaatattatatgttaaatccgcaaaaatcatatttagttaaaaacttaatc
tatcctgtaccaaatcctaattttccatttttaggcgttcactttactagaatgattgac
ggatctatagatataggtccaaatgctgttttaagcttgaaaagagaagggtataaaaaa
agcgacgcaaatatgaaagatttatttgaagtattaacgttccccggtttttggaaatta
gcaggtcaatatatgaaagaaggactcgaagaaatgattcgatcgatgtcaaagaaaaag
tttgtcgaaaatgttcaaaaactcatgcccgatattacagaagaagatttgctgcctgga
ccatctggtgtccgagctcaagctttaagtaaagacggggctttaatcgatgatttttat
attgtaccaacgaaacggtccattcatgtgctgaacgctccatctcctgcagcgacagca
tccattgaaataggaagaacaattgccaaacaaatgatacaacggcagcctatataa

DBGET integrated database retrieval system