KEGG   Aeribacillus pallidus: AP3564_09040Help
Entry
AP3564_09040      CDS       T04993                                 

Definition
(GenBank) HAD family hydrolase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
apak  Aeribacillus pallidus
Pathway
apak00627  Aminobenzoate degradation
apak01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:apak00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    AP3564_09040
Enzymes [BR:apak01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     AP3564_09040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 Hydrolase_3 Acid_phosphat_B TxDE
Motif
Other DBs
NCBI-ProteinID: ASS90357
UniProt: A0A223E517
Position
1873364..1874131
Genome map
AA seq 255 aa AA seqDB search
MKKYKGYFIDLDGTMYRGTEKIEEAEEFVKKLKEKGISYLFMTNNSSKTPKQVAEKLISL
GIPAEEHQILTSSIATANFIWERKQNASIYVIGEEGLRKALEEKGFRFVDENPDFVVVGI
DRNINYEKLAKACLAVRAGATFISTNGDTALPTERGLLPGNGAITSVISVSTNVQPIFIG
KPEKIIVEQGLKMLKTKKEETLLVGDNYETDIKAGIQSGMDTLLVHTGVTTKEHLKDKEI
QPTYTVNNLSEWHVL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaatataaaggatatttcatcgatttagacggcaccatgtatcggggtacagaa
aaaattgaagaagctgaagaatttgttaaaaaactgaaggaaaaaggaatttcgtactta
tttatgacaaacaattcttctaaaaccccgaagcaagtagctgaaaaactaatcagtctc
ggcattccggcggaagagcatcaaattttaacttcaagcattgccacagccaactttatt
tgggaaagaaaacaaaatgcttctatatatgtaatcggtgaagaggggctgcgaaaggcc
ttggaggaaaaaggttttcgcttcgtcgatgaaaatccggattttgtcgttgtgggtatt
gaccgaaacatcaattatgaaaagcttgccaaggcctgtttagcggttcgcgcaggtgca
acatttatttcaacaaacggggatactgctctgccgactgagcgaggactgcttccaggc
aatggcgccattacatcggtcatttcagtatctacaaatgttcagccgatttttatcgga
aaacctgaaaaaattattgtagagcaagggctgaaaatgctgaaaacgaaaaaagaagaa
acgcttcttgtcggagataattacgagacggatattaaggcaggtatccaatcagggatg
gacacccttcttgtgcatacaggcgtaacaacgaaagaacacttaaaagataaagaaata
caaccgacttatacagtgaataacctttcggaatggcatgtgctatga

DBGET integrated database retrieval system