KEGG   Acholeplasma palmae: BN85409500Help
Entry
BN85409500        CDS       T03096                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
apal  Acholeplasma palmae
Pathway
apal00480  Glutathione metabolism
apal00590  Arachidonic acid metabolism
apal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    BN85409500
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BN85409500
Enzymes [BR:apal01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BN85409500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin AHJR-like
Motif
Other DBs
NCBI-ProteinID: CCV64527
UniProt: U4KL74
Position
complement(1046872..1047378)
Genome map
AA seq 168 aa AA seqDB search
MIYDYEVKNIKQENQSLEKYKGQVFLVVNTATKCGYTKQYEGLESLYQDYKDKGFEVLDF
PCNQFLMQAPGSDEELAEFCQLNYFTTFETFSKVKVNGKDASPLFDYLKEQLPVQLTKNK
DGSLEEETTKRIKWNFTKFLIDRNGNVVKRFAPNVTPDMIKPYIEELL
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgatttatgattatgaagtgaaaaatattaaacaagaaaatcaatcattagaaaaatat
aaaggacaagtctttctagtagttaacacagcaaccaaatgtggatatactaagcagtac
gaaggtttagaatcactttatcaagactataaagataaaggctttgaagtattagatttt
ccgtgtaatcaatttttaatgcaagctcctggatcagatgaagaattagcagagttttgt
caattaaactattttacaacatttgaaactttttcaaaagtaaaagttaatggtaaggac
gcaagtcctctatttgattatttgaaagaacaacttcctgttcaattaactaaaaataag
gatggaagtttagaagaagaaacaactaaacgtattaagtggaactttactaagttttta
atagatcgtaatggcaatgtagttaaaagatttgcccctaatgttacacctgatatgatt
aaaccttatatagaagaattattataa

DBGET integrated database retrieval system