KEGG   Acholeplasma palmae: BN85412020Help
Entry
BN85412020        CDS       T03096                                 

Gene name
atoB
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
apal  Acholeplasma palmae
Pathway
apal00071  Fatty acid degradation
apal00072  Synthesis and degradation of ketone bodies
apal00280  Valine, leucine and isoleucine degradation
apal00310  Lysine degradation
apal00362  Benzoate degradation
apal00380  Tryptophan metabolism
apal00620  Pyruvate metabolism
apal00630  Glyoxylate and dicarboxylate metabolism
apal00640  Propanoate metabolism
apal00650  Butanoate metabolism
apal00900  Terpenoid backbone biosynthesis
apal01100  Metabolic pathways
apal01110  Biosynthesis of secondary metabolites
apal01120  Microbial metabolism in diverse environments
apal01130  Biosynthesis of antibiotics
apal01200  Carbon metabolism
apal01212  Fatty acid metabolism
apal02020  Two-component system
Brite
KEGG Orthology (KO) [BR:apal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN85412020 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    BN85412020 (atoB)
   00640 Propanoate metabolism
    BN85412020 (atoB)
   00650 Butanoate metabolism
    BN85412020 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BN85412020 (atoB)
   00072 Synthesis and degradation of ketone bodies
    BN85412020 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN85412020 (atoB)
   00310 Lysine degradation
    BN85412020 (atoB)
   00380 Tryptophan metabolism
    BN85412020 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN85412020 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN85412020 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BN85412020 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:apal04147]
    BN85412020 (atoB)
Enzymes [BR:apal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BN85412020 (atoB)
Exosome [BR:apal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN85412020 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CCV64779
UniProt: U4KLG3
Position
1323100..1324260
Genome map
AA seq 386 aa AA seqDB search
MKNEIVVVSAKRSATGKFKGIYKDLSAVKLGTAVLKDALDAISLNPNDVEYVIMGNVLQA
GLGQNPTRQVAIYAGIPFSVPAFTVNEVCGSGLKSIHLGMQQILLGEAKIVAVGGFENMT
LSPILNDRFTSHSNDSIYKDGLTDAFSNMVMGDTVESLIKEFNISREKQDLFALDSQKRA
HFATVNHYFEKEITPIKVKDLLHTKDEPIRPDTNIDALSHLKTIFDEHGTITAGNASSIN
DGASCLILMEKKEALKRNIPILATIKSFTEVGIEPERMGLAPIYSINNILNKEKLTLDQI
DLFEINESFAGQVLSVLSKLPIPLEKLNVNGGAIALGHPLGSSGSRIVVSLIHELNRQNK
KLGLASLCVGGGIGMSLLIEGNVNEK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaatgaaattgttgttgtaagtgctaaacgtagcgctacaggtaaattcaaagga
atttataaagatttatctgcagttaagttaggcactgctgtattaaaagatgctcttgat
gccattagtttaaatcctaatgatgttgaatatgttattatgggaaatgttttacaagct
ggattaggccaaaatcctacaagacaagttgctatttatgcagggattccttttagtgta
cctgcctttacagtaaatgaagtttgtggttcagggctaaaatctattcacttggggatg
caacaaattcttttgggtgaagcaaaaatagttgctgttggtggatttgaaaatatgact
ttatctcctattttaaatgatagatttactagccactcaaatgattctatttataaagat
ggtcttacagatgcctttagtaatatggtgatgggtgatacagtagaatcacttattaaa
gaatttaatatttctagagaaaaacaagacttatttgcactagatagccaaaaaagggct
cattttgcaactgttaatcattactttgaaaaagaaataacacctataaaagttaaagat
ttactacatacaaaagatgagcctattagacctgatacaaatatagatgccttaagtcat
ttaaaaactatttttgatgaacatgggacaattactgcaggtaatgcttcttctattaat
gatggggcttcttgcctgattttaatggagaaaaaagaagctttaaaaagaaacattcct
attcttgcgactataaaaagttttactgaagttggtattgaacctgaaagaatgggtctt
gctcctatttattcaattaacaatattttaaataaagaaaagcttactttagatcaaatt
gatttatttgaaatcaatgaatcatttgctgggcaagtattatccgttttaagtaaactt
cctattccgttagaaaaacttaatgtgaatggtggagcgattgcattaggtcatccacta
ggttcttctggttctagaattgttgttagtttaatccacgaactgaatagacaaaataaa
aaacttggtcttgcttcattatgtgtaggtggaggtattggtatgagtttattaattgaa
ggtaatgtaaatgaaaaataa

DBGET integrated database retrieval system