KEGG   Acholeplasma palmae: BN85412030Help
Entry
BN85412030        CDS       T03096                                 

Gene name
mvaA
Definition
(GenBank) 3-hydroxy-3-methylglutaryl-coenzyme A reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
apal  Acholeplasma palmae
Pathway
apal00900  Terpenoid backbone biosynthesis
apal01110  Biosynthesis of secondary metabolites
apal01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:apal00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN85412030 (mvaA)
Enzymes [BR:apal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     BN85412030 (mvaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red T4_Gp59_C
Motif
Other DBs
NCBI-ProteinID: CCV64780
UniProt: U4KQL3
Position
1324250..1325491
Genome map
AA seq 413 aa AA seqDB search
MKNNFDKFYFKTKEERIDILKSLNLYDTSLDVSLNEHTASHMIENYLTNFEIPMGLAPNF
LINGKEYVIPMVTEEASVVAAASKAAKIIKENGGFNSFVISRLMTGEIIFHQVKNAKQLM
SLIKSVENTLFKVAQKAHPKIKEIGGGLVSLHTKQIEDFVILYVIVNTKDAMGANTINTI
LEALSSYLETITKEKILMSILSNHSTECLVESYCEINPKTLKFPEEIGMKLTDASRIAHL
DIYRAATHNKGVLNGIDAVVLSTGNDTRAISAAIHSYAASNGSYQSLTKWSVNANGFIVG
SIRIPMPIGTVGGAINVYPLAALSKKILNYKTSEELMMIIASVGLAQNFAAIYALTTDGI
QKGHMSLHARSIAIQTDATSTELPELIKELKISKDFSLDNAKNILNIIRKKDN
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataattttgataaattttattttaaaactaaagaagaacgtatcgatatttta
aaaagtctcaatctatatgatacctctttagatgtttcattaaatgaacataccgctagt
catatgattgaaaactatttaactaattttgagattcctatgggacttgctccaaatttt
ttaattaacggaaaagaatatgtcattccaatggtaactgaggaagcttctgttgtggct
gctgcctcaaaagctgccaaaattattaaagaaaatggcggttttaattcttttgttatt
agtagactaatgactggtgaaatcatttttcatcaagtaaaaaacgcaaaacaattaatg
tcactaattaaatccgttgaaaatactttattcaaggtggctcaaaaagctcatcctaaa
ataaaagaaattggtggaggtttagtttctcttcatactaaacaaatagaagattttgtt
attttatatgtcattgttaataccaaagatgctatgggtgctaatactattaatactatt
ttagaagccctatctagttatcttgaaacaattacaaaagaaaaaattttaatgagtatt
ttatctaatcattctacggaatgcttagtagaatcatattgtgagataaatcctaaaact
ttaaagtttccagaagaaatcggaatgaaattgactgatgctagtagaattgctcattta
gatatctaccgtgccgctactcataataaaggtgttttaaatggaatagatgctgtcgtt
ctttcgactggaaatgatacaagagcaatcagcgcagctattcattcatatgcagcttca
aatggtagttaccaatcacttactaaatggtctgttaatgcaaatggttttattgtaggt
tctattagaattcctatgccaataggaacagttggtggtgcgattaatgtctatccacta
gctgctttatctaaaaagattcttaattataaaacttctgaagaacttatgatgattatt
gcttctgttggtttggctcaaaactttgctgctatttacgctctaacaacagatgggatt
caaaaaggacatatgagtcttcatgctagaagtattgccatccaaacagatgctacttct
actgaattacctgaactcatcaaagagttaaaaataagcaaggatttttcattagataat
gcaaaaaatatattaaacattattagaaaaaaagacaattaa

DBGET integrated database retrieval system