KEGG   Acholeplasma palmae: BN85413450Help
Entry
BN85413450        CDS       T03096                                 

Gene name
rpl22
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
apal  Acholeplasma palmae
Pathway
apal03010  Ribosome
Brite
KEGG Orthology (KO) [BR:apal00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BN85413450 (rpl22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:apal03011]
    BN85413450 (rpl22)
Ribosome [BR:apal03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BN85413450 (rpl22)
  Bacteria
    BN85413450 (rpl22)
  Archaea
    BN85413450 (rpl22)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: CCV64922
UniProt: U4KLV5
Position
complement(1450807..1451142)
Genome map
AA seq 111 aa AA seqDB search
MEAKAIAKTVRIAPRKARLVIDLIRGQNIKEAQAILMFTPRAASPIILKVLNSAVANASH
NLNLDETKLYVKEAYVGEGVRLKRLLPRAKGQGDIIQKRTSHITVVVAERE
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaaaagcaattgcaaaaacagttcgtattgcaccaagaaaagcacgcttagtg
attgatttaatccgtgggcaaaatattaaagaagcacaagctatcttaatgtttacacca
cgcgctgcctcaccaattattttaaaggtgttaaatagtgcagtagctaacgcatcacac
aacttgaacttagacgaaactaaattatatgtaaaagaagcttacgttggagaaggcgta
agacttaaaagattattgccaagagctaaaggtcaaggcgatatcattcaaaaaagaact
agccacattactgtggtagtagcagaaagagaataa

DBGET integrated database retrieval system