KEGG   Candidatus Puniceispirillum marinum: SAR116_0063Help
Entry
SAR116_0063       CDS       T01207                                 

Definition
(GenBank) beta-ketothiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
apb00071  Fatty acid degradation
apb00072  Synthesis and degradation of ketone bodies
apb00280  Valine, leucine and isoleucine degradation
apb00310  Lysine degradation
apb00362  Benzoate degradation
apb00380  Tryptophan metabolism
apb00620  Pyruvate metabolism
apb00630  Glyoxylate and dicarboxylate metabolism
apb00640  Propanoate metabolism
apb00650  Butanoate metabolism
apb00900  Terpenoid backbone biosynthesis
apb01100  Metabolic pathways
apb01110  Biosynthesis of secondary metabolites
apb01120  Microbial metabolism in diverse environments
apb01130  Biosynthesis of antibiotics
apb01200  Carbon metabolism
apb01212  Fatty acid metabolism
apb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:apb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAR116_0063
   00630 Glyoxylate and dicarboxylate metabolism
    SAR116_0063
   00640 Propanoate metabolism
    SAR116_0063
   00650 Butanoate metabolism
    SAR116_0063
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAR116_0063
   00072 Synthesis and degradation of ketone bodies
    SAR116_0063
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAR116_0063
   00310 Lysine degradation
    SAR116_0063
   00380 Tryptophan metabolism
    SAR116_0063
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAR116_0063
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAR116_0063
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAR116_0063
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:apb04147]
    SAR116_0063
Enzymes [BR:apb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAR116_0063
Exosome [BR:apb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAR116_0063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADE38306
UniProt: D5BNN9
Position
64354..65532
Genome map
AA seq 392 aa AA seqDB search
MSDSVVILGGKRSAIGKFGGALAGTSPASLGSIVTKAALESVGVSPHHVDHSVYGNVLHS
EARDVYIARVIALEAGLPTHAPALTVNRLCGSGLQAIISAIQLIQLGDAKIAIGGGVESM
SRTGYLLPQLRFGTKMGDASAIDMMLASLHDPFGNGHMGVTAENIASKFDVSRDEQDSFA
QLSQERAAYAIAEGRFKEQIAGIDIGRGKTASHFDTDEHPRATSKEDLAGLRTIFKEDGS
VTAGNASGINDGAAAVVLASEHEAQAKGLQPMARVLSYGFAAVPPEIMGVGPVPASKMAL
DRAGISVGDLDVVESNEAFAAQACYVSRELGLDPAKVNPNGGAIALGHPVGATGAILTLK
LVYELRRIGGRYGLVTLCIGGGQGISLVVEAL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgtcggattcagttgttattctagggggaaaacgctctgccattggtaaatttggtggc
gcgttagccggaacttctccagcatcattgggtagtattgttaccaaagcggcgttagaa
agcgttggtgtttcgccacatcatgttgatcatagtgtttatggaaatgtactccatagc
gaagcccgtgatgtttatatagcccgcgttatcgcgcttgaggcaggattgccaacacat
gcgcctgcgctaacggtaaataggctttgcggatcgggtttgcaggccattatctcggcc
attcagcttattcaactaggcgatgccaaaatagccataggtggcggtgttgagtctatg
tcccggactggttatctgttgcctcaactcaggttcggaacaaaaatgggagatgcaagt
gctattgatatgatgctagcgtcgcttcatgacccgtttggaaatggacatatgggggta
accgcagaaaacatagcgtccaaattcgacgtttcaagggatgaacaagatagctttgcc
cagctaagccaggaacgtgccgcctatgccatcgccgaaggccggttcaaagaacaaatt
gcaggtattgatatagggcgtggtaaaaccgcaagtcattttgataccgatgagcatcca
cgtgcaacgtcgaaggaagatcttgcagggttgcggactattttcaaggaagatggcagt
gttaccgctggcaatgccagtggtatcaatgatggtgcggcagctgttgttcttgcgagt
gagcatgaggcccaagcaaaggggttgcaaccaatggcgcgggtgctttcctatggcttt
gctgctgtcccacctgaaattatgggtgtggggcctgttccagcgtcaaaaatggcactt
gatcgggccggcatttcagtaggtgatctggatgttgttgaatctaatgaagccttcgct
gcccaagcctgttatgtaagccgcgaattagggcttgatccagctaaagtgaatccgaat
ggcggggccattgcgctggggcatccggttggcgccacgggggctatcctgacattgaag
ctggtgtatgaactgcgccgtattggtggccgttatggattggtgacgctttgcattgga
ggtgggcagggcatttcactggttgtcgaggcactctaa

DBGET integrated database retrieval system