KEGG   Candidatus Puniceispirillum marinum: SAR116_0207Help
Entry
SAR116_0207       CDS       T01207                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase, long form
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
apb00010  Glycolysis / Gluconeogenesis
apb00020  Citrate cycle (TCA cycle)
apb00620  Pyruvate metabolism
apb01100  Metabolic pathways
apb01110  Biosynthesis of secondary metabolites
apb01120  Microbial metabolism in diverse environments
apb01130  Biosynthesis of antibiotics
apb01200  Carbon metabolism
Module
apb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:apb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAR116_0207
   00020 Citrate cycle (TCA cycle)
    SAR116_0207
   00620 Pyruvate metabolism
    SAR116_0207
Enzymes [BR:apb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SAR116_0207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N DUF1359
Motif
Other DBs
NCBI-ProteinID: ADE38450
UniProt: D5BPG8
Position
218861..220174
Genome map
AA seq 437 aa AA seqDB search
MAIEIKMPALSPTMEVGTLSKWMVAVGDDVRSGDVIAEIETDKATMEVEAVDDGKMAQIA
VADGTENIPVGTVIALLAEDGEDVATVSSASPKPAASKLAPPKEDAAGEESGSAAKEAVA
DDATKQEPAMDTSKPAPVSPRTSADTKRIFASPLARRIAADKGVDLASLTGSGPHGRILR
RDVEGAPASMQASLATTAPSRAVTSSAEKGASTLVPNNQMRKIIASRLQESKQTAPHFYL
TIDCNIDTLLESRKALNALADEGIKISVNDMVIRAAAMALMKVPAANASWEGDNTRLFHN
ADICMAVAVDGGLVTPVIWAAESKGLSELSTISSDLATRARDGKLAAEEFTGGSFTISNL
GMFGVREFAAVINPPQGAILAVGAGEQRPVVIDGALSVATMMTVTLSCDHRAVDGAVGAE
WLQAFKGFVENPVTMLL
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggctattgaaatcaaaatgccagctttatcccccacgatggaagttggcacattatca
aaatggatggtggctgttggcgatgatgtgcgttcaggggacgtgatcgccgaaattgaa
accgataaagcgactatggaagttgaagctgttgatgatggtaaaatggcgcaaatagca
gtggctgacggaaccgaaaatatacctgtgggcacggtgattgccttacttgctgaagat
ggtgaagatgttgccactgtgtcatcggcatcgccaaagccagccgcatcaaaactcgct
ccgcccaaagaagatgccgcgggtgaagaaagcggatctgccgcaaaagaagcggtcgca
gatgacgctaccaaacaagagcctgctatggacacatccaagccagcacctgtttctccg
cgcactagcgcggatacgaaacgtatttttgcaagcccattagcgcggcgcatagcggcg
gataagggcgttgatctggctagcctgaccggcagtggcccgcatggtcgtattttgcgg
cgtgatgttgagggcgcgccagcatcgatgcaggcatcgcttgcgaccaccgcgccgtca
cgggctgttacgtcgtctgccgaaaaaggggcgagcacgttggtgccgaacaatcagatg
cgcaagatcatcgcatcgcgtttgcaggaatccaaacagacagccccacatttctatctg
acgattgattgcaatattgacacgctactcgaatcacgcaaggcgctgaacgcactagca
gacgaggggatcaagatttcggtcaatgatatggtgatccgggcggcggcaatggctcta
atgaaggtaccagcggcgaatgcctcatgggaaggtgacaacacacgcctgttccataat
gccgatatctgcatggcggtggcggttgatggcggtctggttacgccggtgatctgggcc
gctgaaagcaaaggcctgtctgaattgtcaaccattagcagcgatctggctacgcgtgcg
cgtgatggcaagcttgcggcggaagaatttaccggtggtagctttaccatttctaacctg
ggcatgttcggggtgcgcgaatttgcggcagtgattaatccgccacagggcgcaatactg
gcagtcggcgcgggcgaacagcgtccggtagtcattgacggtgcattaagtgtggcgacg
atgatgacggtaaccttgtcctgcgatcaccgtgcagttgatggtgcagtaggtgcagaa
tggttgcaggcctttaagggctttgtcgaaaatccggtaacgatgttgctgtaa

DBGET integrated database retrieval system