KEGG   Candidatus Puniceispirillum marinum: SAR116_0358Help
Entry
SAR116_0358       CDS       T01207                                 

Definition
(GenBank) Methionyl-tRNA synthetase, class Ia
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
apb00450  Selenocompound metabolism
apb00970  Aminoacyl-tRNA biosynthesis
apb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SAR116_0358
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SAR116_0358
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:apb01007]
    SAR116_0358
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:apb03016]
    SAR116_0358
Enzymes [BR:apb01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SAR116_0358
Amino acid related enzymes [BR:apb01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SAR116_0358
Transfer RNA biogenesis [BR:apb03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SAR116_0358
 Prokaryotic type
   Other AARSs
    SAR116_0358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ADE38601
UniProt: D5BQA3
Position
378546..380096
Genome map
AA seq 516 aa AA seqDB search
MMSKKFYITTPIYYVNDKPHIGHAYTTLACDVMARFKRLDGFEVKFLTGTDEHGQKVEKA
AQVAGTSPQEFTNAVSQNFRDLTTQLNFSNDDFIRTTEERHKLACQQLWRILLDKGYIRL
DTYAGWYAVRDEAFYTKDEIVDGKAPSGAPVEWVEEPSYFFDLSKFQDKLLAFYEANPDF
VAPASRFNEVKSFVKGGLRDLSVSRASFKWGVPVPDDDAHVMYVWLDALTNYITATGWPV
DGAFGNAETYEKLWPADLHMVGKDILRFHAVYWPAFLMAADLPLPKRVFAHGWWTNEGQK
ISKSLGNVIDPVALSEIYGLDQTRYFLMREVPFGKDGDFSVQAMIQRMNSDLANDLGNLS
QRVISMIFKNCEGVMPALPVSPSPEDNAILTACDALLDQVRIHIDQQSFHEALRSIWDVI
AAANRYVDSQAPWGLKKTDPARMQEVLAVLAEIIRQFAILTQPFMPQSTAKILDQLGVDE
KARGFDTLAGQVRLATGHVIGKPEPVFPRFVEEEPA
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgatgtccaagaagttttatattacaacgccaatttattatgtgaatgacaagccacat
attggtcatgcctatacaacacttgcctgtgatgtcatggcgcgattcaaacgccttgat
ggatttgaggtaaagtttctgacaggtactgacgagcatggtcaaaaggttgaaaaagcg
gcacaggtagctggcacatcacctcaagaatttaccaatgcggtgagccagaatttccgt
gatctaacgacacaattgaatttttcaaatgatgattttattcggactaccgaagaacgt
cataaattagcgtgccagcaattatggcgcattttgctggataaaggttatatcaggctt
gatacttatgcaggctggtatgctgtgcgtgatgaggccttttatacaaaggatgaaatt
gtcgatggcaaagcgccgtcaggtgcgccagttgagtgggtagaagagccatcatatttc
tttgatttatcaaagtttcaggacaaattgctggctttttatgaagccaatcctgatttt
gttgcccctgcaagccgttttaatgaagtgaaaagctttgttaaagggggcttgcgcgat
ctttctgtgagccgtgccagcttcaaatggggcgtacccgtgccagatgatgatgcgcat
gttatgtatgtatggcttgatgccttaaccaattatattaccgcaactggttggccagtt
gatggcgcatttggtaatgctgaaacatatgaaaagctttggccagctgatttgcatatg
gttggcaaggatatcttgcggtttcatgctgtctattggccagcgtttcttatggcagct
gatctgcctttgccaaaacgtgtttttgcacatggctggtggacaaatgaaggtcagaaa
atttcaaaatcacttggtaatgtcattgatccagtagctttatccgaaatatatggccta
gatcaaacgcgctatttcctgatgcgcgaagtgccatttggtaaggatggtgatttttcc
gtgcaggcgatgatacaacggatgaatagtgatcttgcaaatgatctaggcaatctaagc
cagcgggttatttccatgattttcaaaaattgtgagggcgtgatgcccgctttgcctgtc
tccccatcacctgaagataacgccatattgacagcttgcgatgcgttgctggatcaggtg
cgcattcatattgatcagcaaagcttccatgaagctctgaggtctatatgggatgttatc
gccgcggctaatcgctatgtcgatagtcaggcaccatggggtttgaaaaagactgatcct
gcgcgcatgcaagaggtcttggcggtgctggccgaaattatccgtcaatttgctattctg
acacagccattcatgccgcaatcaacggcaaaaattctggatcaacttggtgttgatgaa
aaagcacgcggttttgatacgcttgcgggccaggtacgacttgcaactggtcatgtaatt
ggcaaaccagagcctgtattcccacgttttgtcgaagaagagccagcctaa

DBGET integrated database retrieval system