KEGG   Candidatus Puniceispirillum marinum: SAR116_1827Help
Entry
SAR116_1827       CDS       T01207                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein, putative
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
apb00020  Citrate cycle (TCA cycle)
apb00190  Oxidative phosphorylation
apb00650  Butanoate metabolism
apb01100  Metabolic pathways
apb01110  Biosynthesis of secondary metabolites
apb01120  Microbial metabolism in diverse environments
apb01130  Biosynthesis of antibiotics
apb01200  Carbon metabolism
Module
apb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
apb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
apb_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:apb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAR116_1827
   00650 Butanoate metabolism
    SAR116_1827
  Energy metabolism
   00190 Oxidative phosphorylation
    SAR116_1827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Fumarate_red_D
Motif
Other DBs
NCBI-ProteinID: ADE40070
UniProt: D5BMM7
Position
2025856..2026221
Genome map
AA seq 121 aa AA seqDB search
MVKNSDKTMPRPRVSGLSHWRWQRMSAVAVLMLMAYFVFVVTRIGTLDYAAARAFLATPY
QALALALLVVIGVFHGTLGAHVVIEDYVPVKSGRHALILTVSIIMAIIAGASLIAIASVA
F
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaaattcagacaaaacaatgccaagaccacgggtttccggattgtcgcattgg
cgctggcaacggatgagcgctgtcgctgttttgatgttgatggcctattttgtgtttgtt
gtgacacggattggcactttggattatgcagcggcgcgcgcctttttagcaacgccctat
caggcattggcgctggcattgctggttgtgatcggggtgtttcatggcactttgggcgcc
catgtcgttattgaggattacgtacccgtgaaatctggacgtcatgctcttatattaaca
gtgagtatcataatggcgattattgcgggggcgagtttaatagcgattgcgtcagtagcc
ttttag

DBGET integrated database retrieval system