KEGG   Candidatus Puniceispirillum marinum: SAR116_1985Help
Entry
SAR116_1985       CDS       T01207                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
apb00010  Glycolysis / Gluconeogenesis
apb00052  Galactose metabolism
apb00500  Starch and sucrose metabolism
apb00520  Amino sugar and nucleotide sugar metabolism
apb00521  Streptomycin biosynthesis
apb01100  Metabolic pathways
apb01110  Biosynthesis of secondary metabolites
apb01120  Microbial metabolism in diverse environments
apb01130  Biosynthesis of antibiotics
apb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:apb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAR116_1985
   00052 Galactose metabolism
    SAR116_1985
   00500 Starch and sucrose metabolism
    SAR116_1985
   00520 Amino sugar and nucleotide sugar metabolism
    SAR116_1985
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SAR116_1985
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SAR116_1985
Enzymes [BR:apb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SAR116_1985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: ADE40228
UniProt: D5BN35
Position
2188918..2189892
Genome map
AA seq 324 aa AA seqDB search
MSLLVADIGGTNVRFGVAADATAPLAHVRIMTCASYPTFADAIAAFLGPLDITISYLSVA
VAGPVNDDLVDVTNNHWAFDKGALMQALGVDGILVINDFTAQALAQSDPTANGNVQICAG
ASDHKAPLLVIGPGTGLGVSALIPADGDFVPIEGEGGHVSFAPRTADEIALLAFLNQTMP
HVSAERVVSGSGLENVYAFMAARAQDSDMPVRLGAPEIGAAALADKGIARDAVNLMLGCL
ATVIANAVLTMGTWRGVVIAGGIVPHVQSLLADSPFTARFRHQGRMGVLLETVPVWLSVD
PLAGIKGAQAAMANRYTTARMRRK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagtttactggttgcagatatcggcggcacgaatgtgcgctttggcgtggctgccgat
gccaccgcgccgctggcgcatgtgcggatcatgacatgtgcatcatacccgacctttgcc
gatgcgattgccgcgtttctggggccgcttgatattacgataagctatctttcggttgct
gttgccgggccggtgaatgacgatcttgttgatgtgacgaataatcactgggcgtttgac
aagggggcattgatgcaggcgcttggcgttgacggcattctggtgatcaatgactttacc
gcacaggcgcttgcgcaaagtgatccaacggcaaatggcaatgtacagatttgtgcaggt
gcgtctgaccataaggcgcctttattggtgatcgggccaggtaccggccttggggtttcg
gccttaatccccgcagatggtgattttgtgccgatcgaaggcgaaggtgggcatgtatct
tttgccccgcgaacagcagatgaaatagccctgttggcatttttgaaccagaccatgccg
catgtatcggctgagcgggtcgttagtggatcggggctggaaaatgtttatgcgttcatg
gctgcgcgtgcacaagatagcgatatgcccgtacggcttggcgcgcctgagattggtgcg
gcggcattggccgataagggcattgcccgtgatgcggtaaatctgatgctgggctgtctg
gcaacggtgatcgctaatgccgtgttgacgatggggacatggcgaggggtggtgattgcc
ggcgggattgtgccgcatgtgcaaagcctgcttgccgatagcccctttacagcgcgtttc
cggcatcaagggcgcatgggcgtgttgctggaaacggtgccagtctggttgtcggttgat
ccattagctggcataaagggtgcgcaagcggcaatggctaaccgctatactaccgcccgc
atgcgccggaaatga

DBGET integrated database retrieval system