KEGG   Candidatus Puniceispirillum marinum: SAR116_2171Help
Entry
SAR116_2171       CDS       T01207                                 

Definition
(GenBank) L-allo-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
apb00260  Glycine, serine and threonine metabolism
apb01100  Metabolic pathways
apb01110  Biosynthesis of secondary metabolites
apb01120  Microbial metabolism in diverse environments
apb01130  Biosynthesis of antibiotics
apb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:apb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAR116_2171
Enzymes [BR:apb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     SAR116_2171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Cys_Met_Meta_PP DegT_DnrJ_EryC1 OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: ADE40414
UniProt: D5BNY0
Position
2381828..2382856
Genome map
AA seq 342 aa AA seqDB search
MATGDVLVDFRSDTVTRPTAAMRAVMAKADVGDDVYGDDPNVNDLQDKVAALMGKEAALF
VTSGTQSNLCAMLAHCQRGQEILTGENYHVFIDEAGGASVLGGIMMAPMPTDETGALNGD
DIDRTVKPDDPHCPISSLLCLENTVSGNVQSVDVIDALALRGKAHGLAVHLDGARLMNAA
VKLDVPVRDIVKHADSVSLCLSKGLGAPVGSVLAGSREVISRAYRVRKLVGGGLRQAGLL
AAAGLYALDHHVDRLADDHANALRLAEQLATIPQISVNVDAVQTNMVFMTMAHDAAASLP
AYLQNKGILINGHPSRIRLVTHLDVSAEKIDQFVTELRGFFA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcgacaggcgacgtgcttgttgattttcgcagtgacacggtaacccgcccaaccgcg
gccatgcgtgcggtgatggccaaggctgatgtaggcgatgatgtctatggagacgatccc
aacgtcaatgaccttcaagacaaggtagcagctcttatgggcaaggaagccgcgctgttt
gtgaccagcggcacccagtccaatctatgcgccatgctggcacattgtcagcgtggtcag
gaaatactgactggcgaaaactatcacgtctttattgacgaagctggcggtgcgtctgtg
cttggcggcatcatgatggcaccgatgcctactgacgaaactggcgcattgaatggcgac
gatatcgaccggacggtcaagcctgatgatccgcattgtcctatcagttctttactatgt
ctggaaaacactgtgtccggcaatgtgcaatcggtcgatgtgatcgatgcgctggcgtta
cgtggcaaagcgcatgggctagctgtgcatcttgatggcgcgcgcctgatgaatgcggcg
gtcaagctggatgtgccggtgcgtgatattgtcaaacatgccgacagcgtatcattatgc
ctgtcaaaagggcttggcgcgcctgttggctcggtgcttgctggttcaagggaagtgatc
agtcgtgcttatcgcgtgcgcaaacttgtgggtggtggcttgcgtcaggctggcctactg
gcggctgccgggctttatgcgcttgatcatcatgttgatcgtcttgccgatgaccatgcc
aacgctctgcggctggctgaacagctggcaacgatcccgcagatttcggtcaatgttgat
gctgtgcaaaccaacatggtctttatgactatggcgcatgacgctgccgcatccttgcct
gcatatttgcagaataagggcattttgataaatggccatcctagccgtatccgtctggtg
acgcatctggatgtcagcgctgaaaaaattgaccagtttgtgaccgaattacgtggattt
tttgcctaa

DBGET integrated database retrieval system