KEGG   Alpha proteobacterium HIMB59: HIMB59_00002740Help
Entry
HIMB59_00002740   CDS       T02249                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
apc  Alpha proteobacterium HIMB59
Pathway
apc00071  Fatty acid degradation
apc00280  Valine, leucine and isoleucine degradation
apc00310  Lysine degradation
apc00362  Benzoate degradation
apc00380  Tryptophan metabolism
apc00620  Pyruvate metabolism
apc00630  Glyoxylate and dicarboxylate metabolism
apc00640  Propanoate metabolism
apc00650  Butanoate metabolism
apc00900  Terpenoid backbone biosynthesis
apc01100  Metabolic pathways
apc01110  Biosynthesis of secondary metabolites
apc01120  Microbial metabolism in diverse environments
apc01130  Biosynthesis of antibiotics
apc01200  Carbon metabolism
apc01212  Fatty acid metabolism
apc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:apc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HIMB59_00002740
   00630 Glyoxylate and dicarboxylate metabolism
    HIMB59_00002740
   00640 Propanoate metabolism
    HIMB59_00002740
   00650 Butanoate metabolism
    HIMB59_00002740
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HIMB59_00002740
   00072 Synthesis and degradation of ketone bodies
    HIMB59_00002740
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HIMB59_00002740
   00310 Lysine degradation
    HIMB59_00002740
   00380 Tryptophan metabolism
    HIMB59_00002740
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HIMB59_00002740
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HIMB59_00002740
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HIMB59_00002740
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:apc04147]
    HIMB59_00002740
Enzymes [BR:apc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HIMB59_00002740
Exosome [BR:apc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HIMB59_00002740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SGTA_dimer
Motif
Other DBs
NCBI-ProteinID: AFS48477
UniProt: J9YZE9
Position
complement(251615..252763)
Genome map
AA seq 382 aa AA seqDB search
MSDIYIIDGVRTPIGAYLGQYKKTESVELGTHCLQDLFQRNKKIKKNDAEGLVLGQVLTS
GLGMNTARQVALKSGMAQSSFAYVVNQVCGSGMRAAIEASLKIYTKEFDLVIAGGQESMS
RARHAYLSRTGEKKLGNNVFIDTLVHDGLTDAFSQEHMGITAENVSKKYGVSRLDQDQYA
YGSYVKTYKALKNKYFKNELCQSPLKDEVRQDTTSSKLTQLKPVFKKNGTVTAGNASSLN
DGAAFLAIASHDYVKANKIKPLAKILSWSSSAGNPDYMGITPITAIQKLMKKMSVNISFF
DLIEINEAFAATSVAVQQTLKIDLNKLNIAGGAIALGHPIGCSGTRIVTTLAHQLKRTKQ
KFGVASMCIGGGQGLAMAIERL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatatttatattatcgatggtgttcgtactcctattggtgcctatcttggacaa
tataaaaaaactgaatctgtggaattaggaactcattgtcttcaagatttatttcaacgt
aataaaaaaataaaaaagaatgatgctgagggtttagttttaggccaagtattaacaagt
ggactgggaatgaatacagctcgtcaagttgctttaaaatcaggcatggctcaatcttct
tttgcttatgtagtcaaccaagtctgtggaagtggcatgagagctgcgattgaagcatct
ttaaaaatttacaccaaggaatttgatttagtgattgctggtggacaggaaagcatgtct
cgagcacgtcatgcatatttaagtagaactggtgagaaaaaattaggaaataacgttttc
atcgacactcttgttcatgatggattaactgatgctttttctcaagaacatatgggaatt
acagctgaaaacgtttctaaaaaatatggagtatctcgcttagatcaagatcaatacgca
tatgggtcatatgtaaaaacttataaggctttaaaaaataaatattttaaaaatgaatta
tgtcaatctcccttaaaagacgaagttcgacaagatacgacttcctctaagcttactcag
ctcaaaccagtttttaaaaaaaatggaactgttactgcgggcaatgcctcttccttaaat
gatggagcagcttttttagcgatcgcctcacatgattatgtcaaagctaataaaattaaa
ccacttgctaagattttatcttggtcttcttctgctggtaatccggactatatgggcatc
actcctattacagctattcagaaattgatgaaaaaaatgtcggtaaatataagttttttt
gatcttattgaaattaatgaggcttttgcagcaacctctgttgcagtgcaacaaaccctc
aaaattgatcttaataaacttaatattgctggcggtgctattgccttaggtcatcccatt
ggatgttctggaacaaggatagtaacaactcttgcacatcagctaaaacgcacaaagcaa
aagtttggggtagcaagtatgtgtattggcggtggtcaaggtttagctatggctatagag
cgtctataa

DBGET integrated database retrieval system