KEGG   Alpha proteobacterium HIMB59: HIMB59_00007600Help
Entry
HIMB59_00007600   CDS       T02249                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
apc  Alpha proteobacterium HIMB59
Pathway
apc00260  Glycine, serine and threonine metabolism
apc00750  Vitamin B6 metabolism
apc01100  Metabolic pathways
apc01110  Biosynthesis of secondary metabolites
apc01120  Microbial metabolism in diverse environments
apc01230  Biosynthesis of amino acids
Module
apc_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:apc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HIMB59_00007600
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HIMB59_00007600
Enzymes [BR:apc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HIMB59_00007600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP ERF Malic_M SWIB zf-Tim10_DDP
Motif
Other DBs
NCBI-ProteinID: AFS48957
UniProt: J9Z0J0
Position
702006..703358
Genome map
AA seq 450 aa AA seqDB search
MNYVSTRNNQINFSSEQVLNYGLAPDGGLFIPSELPKFSSEDLNNLKNADYKEIAYFVLN
PFLKDLFSEKEIKHLISDAYQSFDEGIVSITELGENQLLNLFHGPTLAFKDYAMCLLAKI
YELYLRKKNQKLVIVGATSGDTGSAAIHAFKGIENIDIFILHPHNATSLFQRKQMTTSGA
DNVFNIALEGSFDDCQTLVKKTFNDQELSTKYHFTAINSINWFRILPQSIYYAWAYLNHN
VDSFVVPSGNFGNIYSAHLLKSMGFPLKNLVIATNENNILHRIIANNDFSLTDVIKTNSP
SMDITISSNFERILAESFNPEELSHLYQNLINHAHNPKLDETVHEQLAGKFKSEYATSEE
VQKCIKKYFDSNNVLIDPHTAVGVVCAEKMNLSNHMCLACAHPVKFQETVTKSLGHEIEY
DKNFEFKSSEKFEILKNDYNLLKEFILNNA
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaattatgtcagcactcgtaataatcaaataaatttcagttctgaacaagttttgaac
tatggcttggctccagatggaggattatttattccaagtgaacttccaaagttttcttca
gaggatttaaataacttaaaaaacgctgactacaaagaaatagcatattttgttctaaac
ccttttttaaaagatttattttcagagaaagaaataaaacacctgatttcagatgcttat
caaagttttgatgaaggaatcgtctctataactgagttaggtgaaaatcaattattaaat
ttatttcatgggccaacattagcttttaaagattacgcaatgtgtcttttagctaaaata
tatgagctatatcttagaaaaaaaaatcaaaaactagtaattgtgggagcaacttcaggt
gatacaggttctgcagcaattcatgctttcaagggtattgaaaatatagatatttttatt
cttcaccctcataacgccacatctcttttccaaagaaaacagatgacaactagtggagct
gacaatgtatttaatattgctcttgagggaagttttgatgattgccagactttggtaaaa
aaaacttttaatgatcaagaactaagtaccaaatatcatttcacagcgatcaactctatc
aattggtttagaatattgcctcaatctatttattatgcttgggcttatctaaatcacaat
gttgatagcttcgtagtaccaagtggaaatttcggaaatatctattcagcacacctttta
aagtcaatgggctttccccttaaaaatcttgttatagcgactaatgaaaataatatttta
catagaattatagctaacaatgatttttcattaactgatgtaattaaaacaaatagccca
agtatggacataaccatttcaagtaattttgaacgaattttagcagagtcatttaaccca
gaagaattatctcatttatatcaaaatttgataaatcacgcacacaaccccaaactagat
gagactgtccacgagcagttggctggtaaatttaagtcagagtatgcaacatcagaagaa
gtccaaaaatgtatcaagaaatactttgatagtaataatgttttgattgacccacatacc
gctgttggggtagtttgtgcggaaaaaatgaatttaagtaatcatatgtgcttggcttgt
gcccatccggtaaaatttcaagaaaccgtaacaaaatctctcggtcatgaaattgaatat
gataaaaactttgaatttaagagtagtgaaaaatttgaaatactaaaaaatgattataat
cttttgaaggagtttattttaaacaatgcctaa

DBGET integrated database retrieval system