KEGG   Alpha proteobacterium HIMB59: HIMB59_00010810Help
Entry
HIMB59_00010810   CDS       T02249                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
apc  Alpha proteobacterium HIMB59
Brite
Enzymes [BR:apc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     HIMB59_00010810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD MTS Methyltransf_PK Methyltransf_25 Methyltransf_23 Methyltransf_31 Methyltransf_12 Spermine_synth LRAT
Motif
Other DBs
NCBI-ProteinID: AFS49265
UniProt: J9Z205
Position
979551..980213
Genome map
AA seq 220 aa AA seqDB search
MNFEQARSNMVLNQLRANRIRDIDLIEKIEDFPREDLFPKNLKHLSYSDQIITLEQGRFI
LPPLTSSHLVQCLDLKSDDNVLEVGSGIGTITSIINQYTTSIDCIESSEALIETFKKSLS
ENLFQANLLKTSIESFFSNKNPNVNKYNKIIINGSLDVEPSQIIKKASENATIVCVIDNQ
EIKHKIVKYVKVNNNCNRFIVEEALSNYLYRFITKEPFVF
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgaacaagctagatctaatatggttttaaaccaactaagagcaaatcgtatt
agagatatcgatttaattgaaaaaattgaagattttcctcgagaggatttgtttcccaaa
aatttaaaacatctatcttattctgatcaaattataacattagagcagggtagattcatc
ttacctccacttacttcgagtcatttggttcaatgtctagatttaaaaagtgatgataac
gtattggaagttggctctggaataggaacgattacttctattatcaatcaatatacaact
tccattgattgcattgaaagttctgaagcattaattgaaacttttaaaaaaagtttaagt
gaaaatttattccaagctaatcttttaaaaacttcaattgagagttttttttcaaataaa
aacccgaatgttaacaaatataataaaataattattaatggttcccttgacgttgagcca
tctcaaattattaaaaaagcatcagaaaatgcgacgatagtttgtgtaatagataaccaa
gagattaaacataaaatagttaaatacgtaaaagttaacaataattgtaatcgatttatt
gttgaagaagctctatctaattatctttataggtttattaccaaagaacctttcgttttt
taa

DBGET integrated database retrieval system