KEGG   Alpha proteobacterium HIMB59: HIMB59_00012360Help
Entry
HIMB59_00012360   CDS       T02249                                 

Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
apc  Alpha proteobacterium HIMB59
Pathway
apc00010  Glycolysis / Gluconeogenesis
apc00051  Fructose and mannose metabolism
apc00562  Inositol phosphate metabolism
apc01100  Metabolic pathways
apc01110  Biosynthesis of secondary metabolites
apc01120  Microbial metabolism in diverse environments
apc01130  Biosynthesis of antibiotics
apc01200  Carbon metabolism
apc01230  Biosynthesis of amino acids
Module
apc_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:apc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HIMB59_00012360
   00051 Fructose and mannose metabolism
    HIMB59_00012360
   00562 Inositol phosphate metabolism
    HIMB59_00012360
Enzymes [BR:apc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HIMB59_00012360
Exosome [BR:apc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HIMB59_00012360
  Exosomal proteins of bladder cancer cells
   HIMB59_00012360
  Exosomal proteins of melanoma cells
   HIMB59_00012360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DUF4849
Motif
Other DBs
NCBI-ProteinID: AFS49416
UniProt: J9Z2T3
Position
complement(1126762..1127472)
Genome map
AA seq 236 aa AA seqDB search
MKYIIFNWKSYLNLKESVKLSNIISGFKKSKKFKIISAPNNFFHLALSEKFKKNLYATQN
FDLDGRGASTGSLDISHLIENKIKYTIIGHSEMRSNHGENDKIVSKKLELSINNKLIPIV
CIGESLNIYKSKKTKPYLRSQINTIFKKTAKYDQIILAYEPLWSIGTGLTPELSEIEDIC
KFLSKILEKYTFKKINILYGGSVNLSNISEILNLQFVNGVLVGSASTKSSFIKYFK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatataatatttaattggaaatcatatttaaatcttaaagagtctgtaaagctt
tcaaatattatttcaggatttaaaaagagcaaaaaatttaaaataatatctgctccaaat
aatttttttcatttagcattatcagaaaaatttaaaaaaaacttatatgcaactcaaaat
tttgatttggatggaaggggagctagcactggctcattagatatttcccatctcatagaa
aataaaattaaatatacaataattggtcattcagaaatgagatctaatcatggtgaaaat
gataaaattgtaagtaagaagttagagttatctattaataataagttgatcccgatagtt
tgtatcggcgagtctttaaatatttataaatctaaaaaaactaaaccgtatcttcgtagt
caaattaacactatttttaaaaaaaccgcgaagtacgaccaaattatcttagcatatgaa
cctttatggtctattggcactggattaacaccagaattatcagaaattgaagatatttgt
aaatttttaagtaaaattcttgaaaaatatacttttaaaaaaattaatattttatatggt
ggttcggtaaatttaagtaatatttcggaaatcttaaatttacaatttgttaacggcgtt
ttagttggatcagcctcaactaaatcttcgtttattaaatattttaaataa

DBGET integrated database retrieval system