KEGG   Alpha proteobacterium HIMB59: HIMB59_00014960Help
Entry
HIMB59_00014960   CDS       T02249                                 

Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
apc  Alpha proteobacterium HIMB59
Pathway
apc00540  Lipopolysaccharide biosynthesis
apc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HIMB59_00014960
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:apc01005]
    HIMB59_00014960
Enzymes [BR:apc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     HIMB59_00014960
Lipopolysaccharide biosynthesis proteins [BR:apc01005]
 Unusual sugar
  HIMB59_00014960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind NAD_binding_4
Motif
Other DBs
NCBI-ProteinID: AFS49668
UniProt: J9Z1K0
Position
complement(1375703..1376626)
Genome map
AA seq 307 aa AA seqDB search
MIIVTGGAGFIGSNLIEGLNKIGIEDIILVDDVKTANRKNIKNLIYKKQYSIKELIRRIN
KNQIGNIDCIFHQGACSNTLESRVDYILENNFYYSKKLLDFSIKKNIKFIYASSASVYGR
SIDTTEKIENENPLNLYAISKLLFDNYVRSKLNSKNQITGLRYFNVYGKNESHKNNMASV
IFHFSEQLKNTNEVKIFGNSLGYKNGEHKRDFIHVDDVISVNLWFLKVKKSGIFNVGTGK
AVSFNKVAKILSKDFTKSKISYIPFPKKLLKFYQPYTKAKINSLKTIGYKKKFINLKEGV
SKYFYEN
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgattatagttactggtggcgcaggctttattgggtctaatttaattgaaggcctcaat
aaaattggtatcgaagacattattctggtagatgatgttaaaacagcaaatagaaaaaat
attaaaaatcttatttataagaaacaatattcaattaaagaattaattagacgaattaat
aaaaatcagattggaaatattgattgtatttttcatcagggcgcctgttctaatacttta
gagagtagagtcgattatattttagagaataatttttattactcaaaaaagttattagat
ttttcaataaaaaaaaatattaaattcatatatgcatcatcagcttcagtatatggaaga
tcaattgacactacagaaaaaatagaaaatgaaaaccctttaaatctttatgctatttca
aaactattatttgataattatgttagatctaaactaaattccaaaaatcaaataaccggc
ttaagatattttaatgtttatggaaaaaatgaatcccataagaataatatggcaagtgtt
atctttcattttagcgaacaattaaaaaatactaatgaggtaaaaatatttggaaattct
ttaggttataaaaatggtgagcacaaaagagactttattcatgtagatgatgttatttca
gtgaacttgtggtttttaaaagtaaaaaaatcaggtatttttaacgttggaacaggcaaa
gctgtaagttttaataaagtagcaaaaatcttatcaaaagattttacgaaatccaaaatt
tcttatattccttttcctaaaaaattattaaaattttatcaaccttacacaaaagctaaa
attaacagtcttaaaacaattggatataaaaaaaaatttataaatttaaaggagggtgta
tcaaaatacttttatgaaaattaa

DBGET integrated database retrieval system