KEGG   Anaplasma phagocytophilum Dog2: YYY_05210Help
Entry
YYY_05210         CDS       T02752                                 

Definition
(GenBank) magnesium transporter ApaG
  KO
K06195  ApaG protein
Organism
apd  Anaplasma phagocytophilum Dog2
Brite
KEGG Orthology (KO) [BR:apd00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    YYY_05210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AGR81537
Position
1182840..1183247
Genome map
AA seq 135 aa AA seqDB search
MTVLECGKEAGLIEVEVTPSYLEEHSIPHENCYIWLYSVRINNRSDSTVQLLKRSWKIID
SKGVVNEVSGSGVAGSQPVLKPGAFFEYTSGTCLSTPSGVMNGWYQFVDEDKAQVFYVDV
PAFSLDSPYDSLRLN
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgacagtgttagagtgtggcaaagaagcaggactaatagaggtagaagtaaccccaagt
tatttagaagagcattctataccgcatgagaactgttacatatggctatatagtgtacgg
ataaacaatagaagtgattctacagttcagctgcttaagcgcagttggaagatcatagat
tccaaaggagtcgtgaatgaggtcagcggatccggagtagctggcagtcagccggtactg
aagccgggagcttttttcgagtatacaagtggtacgtgtttaagtactccttcgggagtg
atgaacggctggtatcagtttgtggatgaggataaggcacaggtgttttatgtggatgtg
ccggcattttcattagatagcccctacgatagtttgaggctgaactaa

DBGET integrated database retrieval system