KEGG   Aeropyrum pernix: APE_0051
Entry
APE_0051          CDS       T00023                                 

Definition
(GenBank) phosphate transport system protein PhoU
  KO
K02039  phosphate transport system protein
Organism
ape  Aeropyrum pernix
Brite
KEGG Orthology (KO) [BR:ape00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    APE_0051
SSDB
Motif
Pfam: PhoU LPD3 PMC2NT
Other DBs
NCBI-ProteinID: BAA78960
UniProt: Q9YG50
Position
30668..31273
AA seq 201 aa
MSVEPARRDLEAIYSNLDRMYNIVVKIVADTLRSLEEWSINEALEDHLYLAENLSAVVEE
QATFFIAKYQPLGPELLEAKSLIRTSYDLYRIARYCREINRVIAYTSRGGRTLKPSQQVR
KAAEIVASMVGDAYKAYRSRDNELRRKVEETDNMIDKIYDAMLERIGKVESLSQTEAVDL
LIVRHLERIADHAVYIARQAE
NT seq 606 nt   +upstreamnt  +downstreamnt
gtgagtgtagagccggcgagaagggacctcgaagctatatattcgaacctcgacagaatg
tacaacattgttgtgaagatagttgcagacacgctgaggagcctagaggagtggagcatt
aatgaggcgctcgaggaccacctatacctggcagagaacctctcggccgtcgttgaggag
caggctacattcttcatagcaaagtatcagcctctaggccccgaactcctcgaggccaag
tcgctgataagaacctcctatgatctctacaggatagcgaggtactgcagagagataaat
cgagttatagcctatacgagcagaggaggcaggaccctgaaaccctctcagcaggtgaga
aaggcagcggagatagtggcctccatggttggagatgcatacaaggcctacagatccagg
gacaatgagctacgaaggaaagttgaagagacagacaacatgatagacaagatatacgat
gcgatgctcgagaggatagggaaagtagaatcgctgagtcagaccgaagcggtagacctc
ctcatagtaaggcatctagagaggattgcagaccacgcagtctatattgccaggcaagcc
gaatag

DBGET integrated database retrieval system