KEGG   Aeropyrum pernix: APE_0162
Entry
APE_0162          CDS       T00023                                 
Name
(GenBank) DNA polymerase sliding clamp A
  KO
K04802  proliferating cell nuclear antigen
Organism
ape  Aeropyrum pernix
Pathway
ape03030  DNA replication
ape03410  Base excision repair
ape03420  Nucleotide excision repair
ape03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ape00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    APE_0162
   03410 Base excision repair
    APE_0162
   03420 Nucleotide excision repair
    APE_0162
   03430 Mismatch repair
    APE_0162
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ape03032]
    APE_0162
   03400 DNA repair and recombination proteins [BR:ape03400]
    APE_0162
DNA replication proteins [BR:ape03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    APE_0162
DNA repair and recombination proteins [BR:ape03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     APE_0162
   MMR (mismatch excision repair)
    Other MMR factors
     APE_0162
  TLS (translesion DNA synthesis) factors
   Other TLS factors
    APE_0162
SSDB
Motif
Pfam: PCNA_N PCNA_C
Other DBs
NCBI-ProteinID: BAA79073
UniProt: Q9YFT8
Structure
Position
complement(121827..122618)
AA seq 263 aa
MSSEATLDSEFTDYKAMFRYEAKVFKELVDSVSKILDEGLFIITGEGLRLRGMDPARVAL
VDIEIPSSSFFDFYMAGDVERVELGVNMETLKGVVARAKKGDQLEVRVREDKVLFIVESV
VLRRYLLPNLEVIVDVPEDISLEFDATATVIADVVKKTLRDVELVGDIVEFDAGEDYLSI
RSVGPERRRVETRLTRESPALIDLEVKEPATSRYDVGYLKRMLGVAKIAESIELSFSTDK
PLKMVFKSPDGSRVTYLLAPSTG
NT seq 792 nt   +upstreamnt  +downstreamnt
gtgtcctctgaggccaccctagactcagagtttaccgattataaggctatgtttagatac
gaggctaaggtgtttaaggaactagtagacagcgtgtctaaaatcctggacgagggcctg
tttataataacaggagagggtctgaggcttagaggcatggatccggcgagggttgcatta
gtcgacatagaaataccgtcttcatcattcttcgacttctacatggctggggatgtcgag
cgtgtggagctaggcgttaacatggagactcttaagggtgtagtggcgagggcaaagaag
ggtgaccagctggaggtaagggttagggaggataaagtcctgttcatcgtcgagagcgtt
gtcctgaggaggtatcttctccccaatcttgaagttatagtggatgttcctgaggatatc
tccctcgagttcgacgccaccgccactgttatagctgacgttgttaagaaaacactgcgt
gatgtcgagcttgtgggagatattgtggagttcgacgctggcgaggattatctttccata
aggagtgtaggtcctgagaggagaagggtagagaccaggctaactagggagagccccgcc
ctgatagaccttgaggttaaggagccggccacaagcaggtacgacgtgggctacttgaag
aggatgcttggtgtggctaagatagctgagagcatagagctgtcgttctccaccgacaag
cctttgaagatggtgttcaagtcgccggacggcagtagggttacctaccttttagctccc
tcgacaggttag

DBGET integrated database retrieval system